Result : E3YBA4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Methanobactin mb-OB3b (Copper-binding compound) (CBC) (Hydrogen peroxide reductase) (EC 1.11.1.-) (Superoxide dismutase) (EC 1.15.1.1) |
| NCBI Accession ID | ADVE01000073.1 |
| Organism | Methylosinus trichosporium |
| Left | 6297 |
| Right | 6389 |
| Strand | + |
| Nucleotide Sequence | ATGACTGTCAAGATTGCTCAGAAGAAAGTCCTTCCGGTCATCGGTCGCGCGGCTGCGCTTTGCGGTTCGTGCTATCCGTGCAGCTGCATGTGA |
| Sequence | MTVKIAQKKVLPVIGRAAALCGSCYPCSCM |
| Source of smORF | Swiss-Prot |
| Function | Chalkophore involved in scavenging, uptake and suppression of toxicity of copper. Each apo-methanobactin (apo-mb) complexes 1 Cu(2+) or Cu(1+) ion to form Cu(1+)-mb (Cu-mb) which is then taken up by the cell. Enhances growth rate in the presence of copper and reduces growth lag upon exposition to elevated levels of copper. Cu-mb contributes to the switchover from soluble methane monooxygenase (sMMO) to the membrane-bound particulate MMO (pMMO) by inducing transcription of pMMO subunit A. It also stimulates the enzymatic activity of pMMO. In the absence of copper, binds other metal ions, like Zn(2+), Ag(1+), Au(3+), Co(2+), Cd(2+), Fe(3+), Hg(2+), Mn(2+), Ni(2+), Pb(2+) or U(6+), but not Ba(2+), Ca(2+), La(2+), Mg(2+) or Sr(2+). Uptake is an active process, which may involve TonB-dependent transporters, and as such does not involve porins. Cu-Mb can be taken up by other methanotrophic bacteria but not by E.coli. Has Cu-dependent superoxide dismutase-like activity. Shows reductant-dependent oxidase and hydrogen peroxide reductase activities. Reduces copper-levels in liver in a rat model of Wilson disease. {ECO:0000269|Pubmed:15361623, ECO:0000269|Pubmed:15794651, ECO:0000269|Pubmed:16207923, ECO:0000269|Pubmed:16332035, ECO:0000269|Pubmed:16445286, ECO:0000269|Pubmed:17070918, ECO:0000269|Pubmed:17615240, ECO:0000269|Pubmed:18372044, ECO:0000269|Pubmed:20817303, ECO:0000269|Pubmed:20961038, ECO:0000269|Pubmed:21242075, ECO:0000269|Pubmed:21254756, ECO:0000269|Pubmed:21900235}. |
| Pubmed ID | 20952571 15361623 15794651 16332035 16207923 16445286 17070918 17615240 18372044 20961038 20817303 21299876 21254756 21900235 21242075 18729522 |
| Domain | CDD:274960 |
| Functional Category | Metal-binding |
| Uniprot ID | E3YBA4 |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1393877 | 1393966 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 2 | 873929 | 874018 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
++ More..