Result : E2FZM4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein SocA (Small ORF induced by copper A) |
| NCBI Accession ID | HM222605.1 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 106 |
| Right | 291 |
| Strand | + |
| Nucleotide Sequence | ATGCACAGGCGGGCAAGGCGAATGCCGATGCGACCCCGACGAAGTAAGAGGGTACGTAATCGATACACCATGGGGACATTTGCCCTCCATGGCCTCACCCATCGCCTACCGTCGGCCTCGTTGCAGACGACGGCTGCCCGCCACCCGGATGTGACGCAATTCTCAATGCCTGGGCACTACCGATAA |
| Sequence | MHRRARRMPMRPRRSKRVRNRYTMGTFALHGLTHRLPSASLQTTAARHPDVTQFSMPGHYR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 21166899 9634230 24549843 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | E2FZM4 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1934124 | 1934309 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1963611 | 1963796 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13578.8 | 1.0 | 2 | 4292.0 | opposite-strand | Methyltransferase domain |
| 2 | PF00324.23 | 1.0 | 2 | 2668.0 | opposite-strand | Amino acid permease |
| 3 | PF13520.8 | 1.0 | 2 | 2668.0 | opposite-strand | Amino acid permease |
| 4 | PF00823.21 | 1.0 | 2 | 858.0 | opposite-strand | PPE family |
| 5 | PF12484.10 | 1.0 | 2 | 858.0 | opposite-strand | PPE-SVP subfamily C-terminal region |
| 6 | PF01740.23 | 1.0 | 2 | 573.0 | same-strand | STAS domain |
| 7 | PF13614.8 | 1.0 | 2 | 2144.0 | same-strand | AAA domain |
| 8 | PF01656.25 | 1.0 | 2 | 2144.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 9 | PF06564.14 | 1.0 | 2 | 2144.0 | same-strand | Cellulose biosynthesis protein BcsQ |
| 10 | PF00142.20 | 1.0 | 2 | 2144.0 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 11 | PF02616.16 | 1.0 | 2 | 3004.0 | same-strand | Segregation and condensation protein ScpA |
| 12 | PF04079.18 | 1.0 | 2 | 3837.0 | same-strand | Segregation and condensation complex subunit ScpB |
++ More..