Result : D5UU90
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Tpau_2998 |
| NCBI Accession ID | CP001966.1 |
| Organism | Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / JCM 10117 / NBRC 16120 / NCTC 13040) (Corynebacterium paurometabolum) |
| Left | 3108102 |
| Right | 3108305 |
| Strand | + |
| Nucleotide Sequence | ATGCAGCCCGTCGAATCGAGCGCGATCGAAGCAGCAGGCTACGACCCCGCAGAACAGATCCTGGCCCTCCGATTCACCGGCGGAGCCACCTATCTGTACTACGAGGTCCCGCCAGAGGTCTTCGACGATCTTCTCGCTGCCGAGTCCACGGGGCGGTTCGTCAACGGCATCGTCAAACCGCGCTTCCGCGCCGTCGCACTCTGA |
| Sequence | MQPVESSAIEAAGYDPAEQILALRFTGGATYLYYEVPPEVFDDLLAAESTGRFVNGIVKPRFRAVAL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13619. Profile Description: KTSC domain. This short domain is named after Lysine tRNA synthetase C-terminal domain. It is found at the C-terminus of some Lysyl tRNA synthetases as well as a single domain in bacterial proteins. The domain is about 60 amino acids in length and contains a reasonably conserved YXY motif in the centre of the sequence. The function of this domain is unknown but it could be an RNA binding domain. |
| Pubmed ID | |
| Domain | CDD:404502 |
| Functional Category | Others |
| Uniprot ID | D5UU90 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3108102 | 3108305 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 2 | 26167 | 26382 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 3 | 3356607 | 3356792 | + | NZ_CP036276.1 | Symmachiella dynata |
++ More..