| Protein name |
Uncharacterized protein Tpau_2998 |
| NCBI Accession ID |
CP001966.1 |
| Organism |
Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / JCM 10117 / NBRC 16120 / NCTC 13040) (Corynebacterium paurometabolum) |
| Left |
3108102 |
| Right |
3108305 |
| Strand |
+ |
| Nucleotide Sequence |
ATGCAGCCCGTCGAATCGAGCGCGATCGAAGCAGCAGGCTACGACCCCGCAGAACAGATCCTGGCCCTCCGATTCACCGGCGGAGCCACCTATCTGTACTACGAGGTCCCGCCAGAGGTCTTCGACGATCTTCTCGCTGCCGAGTCCACGGGGCGGTTCGTCAACGGCATCGTCAAACCGCGCTTCCGCGCCGTCGCACTCTGA |
| Sequence |
MQPVESSAIEAAGYDPAEQILALRFTGGATYLYYEVPPEVFDDLLAAESTGRFVNGIVKPRFRAVAL |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of pfam13619. Profile Description: KTSC domain. This short domain is named after Lysine tRNA synthetase C-terminal domain. It is found at the C-terminus of some Lysyl tRNA synthetases as well as a single domain in bacterial proteins. The domain is about 60 amino acids in length and contains a reasonably conserved YXY motif in the centre of the sequence. The function of this domain is unknown but it could be an RNA binding domain. |
| Pubmed ID |
|
| Domain |
CDD:404502 |
| Functional Category |
Others |
| Uniprot ID |
D5UU90
|
| ORF Length (Amino Acid) |
67 |