Protein Information |
Information Type | Description |
---|---|
Protein name | N(2)-fixation sustaining protein CowN (CO weal-nitrogenase) |
NCBI Accession ID | CP001312.1 |
Organism | Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) |
Left | 616010 |
Right | 616288 |
Strand | + |
Nucleotide Sequence | ATGAACGACCAGACCCCCGACCGTTACGTGACCTTCATGGGCATCGCCTGTGACACGAATGCCGACCGCCTGTGCGAGATGCTGGCGGCGCGGATGGCGGGCAATGACTCGCGCTGGGTCGCCTATTTCGAGAAGAAACTGGCCGAGAATGCGCAGATGGGCCACGACCGGCTGCGGTTCATCGGGGCGCAGGTGAATGCGCTGATGTCCTTCTTCGAAGAGGAAGACGACGAAGCGGCCTTGGCGCTGCTCTGGCATATCGAGCATCACTGCCTCTGA |
Sequence | MNDQTPDRYVTFMGIACDTNADRLCEMLAARMAGNDSRWVAYFEKKLAENAQMGHDRLRFIGAQVNALMSFFEEEDDEAALALLWHIEHHCL |
Source of smORF | Swiss-Prot |
Function | Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. {ECO:0000255|HAMAP-Rule:MF_02117}. |
Pubmed ID | 20418398 |
Domain | CDD:411285 |
Functional Category | Others |
Uniprot ID | D5ANI6 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 605464 | 605742 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
2 | 2787009 | 2787287 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13545.8 | 1.0 | 2 | 68.0 | same-strand | Crp-like helix-turn-helix domain |