Result : A1UKF3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) |
| NCBI Accession ID | CP000518.1 |
| Organism | Mycobacterium sp. (strain KMS) |
| Left | 4352322 |
| Right | 4352606 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGTGTTGACCGACGATCAGGTGGACGCCGCACTGCCGGAGCTGGGCGGCTGGGAGCGCGCCGACGGGGCGCTGCGCCGCTCGGTGAAGTTCCCGGCGTTTCTCGACGGCATCGAGGCGGTGCGCCGGGTGGCTGAGCGCGCCGAGGCGAAAGACCACCATCCCGATATCGATATCCGTTGGCGGACAGTGACTTTCGTACTCGTCACACATTCCGAGGGCGGTATCACGGAGAAGGATCTGCAGATGGCTCGGGAGATCGACGAGATCCTCGACCGGTAG |
| Sequence | MAVLTDDQVDAALPELGGWERADGALRRSVKFPAFLDGIEAVRRVAERAEAKDHHPDIDIRWRTVTFVLVTHSEGGITEKDLQMAREIDEILDR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00942. Profile Description: N/A. Pterin 4 alpha carbinolamine dehydratase is also known as DCoH (dimerization cofactor of hepatocyte nuclear factor 1-alpha). |
| Pubmed ID | |
| Domain | CDD:412663 |
| Functional Category | Others |
| Uniprot ID | A1UKF3 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 127
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 319722 | 320006 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 2 | 239233 | 239517 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 3 | 2901609 | 2901893 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 4 | 4891274 | 4891555 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 5 | 2319353 | 2319634 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 6 | 4853001 | 4853282 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 7 | 3655387 | 3655671 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 8 | 4547661 | 4547942 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 9 | 4514695 | 4514976 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 10 | 2896871 | 2897152 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 11 | 3000005 | 3000289 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 12 | 3630863 | 3631144 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 13 | 2913244 | 2913537 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 14 | 4692667 | 4692960 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 15 | 5264529 | 5264825 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 16 | 5360941 | 5361225 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 17 | 5469874 | 5470158 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 18 | 4306415 | 4306699 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 19 | 5083576 | 5083869 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 20 | 109892 | 110176 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 21 | 2126374 | 2126658 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 22 | 485981 | 486265 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 23 | 1174801 | 1175085 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 24 | 2039616 | 2039897 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 25 | 3126468 | 3126752 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 26 | 3085246 | 3085530 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 27 | 5267661 | 5267945 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 28 | 2727451 | 2727732 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 29 | 3320607 | 3320891 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 30 | 5226899 | 5227183 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 31 | 2305295 | 2305579 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 32 | 1202662 | 1202946 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 33 | 1215758 | 1216042 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 34 | 1422448 | 1422738 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 35 | 1170195 | 1170479 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 36 | 396716 | 397015 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 37 | 764940 | 765224 | + | NZ_AP022562.1 | Mycobacterium novum |
| 38 | 1662256 | 1662540 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 39 | 1822180 | 1822464 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 40 | 4486093 | 4486377 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 41 | 4570805 | 4571077 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 42 | 2756423 | 2756710 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 43 | 2609469 | 2609741 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 44 | 792028 | 792312 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 45 | 157365 | 157646 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 46 | 4126155 | 4126439 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 47 | 2802087 | 2802371 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 48 | 2868987 | 2869271 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 49 | 1164796 | 1165071 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 50 | 3201088 | 3201372 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 51 | 1129613 | 1129906 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 52 | 1420614 | 1420898 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 53 | 5010151 | 5010435 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 54 | 117698 | 117982 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 55 | 628715 | 629005 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 56 | 1145392 | 1145676 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 57 | 4027674 | 4027958 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 58 | 2668410 | 2668697 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 59 | 4403166 | 4403453 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 60 | 884159 | 884452 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 61 | 5257340 | 5257624 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 62 | 4831480 | 4831764 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 63 | 397016 | 397300 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 64 | 999584 | 999868 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 65 | 5671135 | 5671419 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 66 | 4428893 | 4429174 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 67 | 3076455 | 3076739 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 68 | 2955133 | 2955417 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 69 | 687863 | 688147 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 70 | 1286284 | 1286568 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 71 | 1306399 | 1306683 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 72 | 3960692 | 3960985 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 73 | 1268921 | 1269205 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 74 | 1246826 | 1247110 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 75 | 1291952 | 1292236 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 76 | 1770467 | 1770751 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 77 | 1156583 | 1156867 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 78 | 1166896 | 1167180 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 79 | 1217738 | 1218022 | - | NC_015576.1 | Mycolicibacter sinensis |
| 80 | 1403006 | 1403290 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 81 | 4030990 | 4031283 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 82 | 1645537 | 1645833 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 83 | 1310750 | 1311001 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
| 84 | 946806 | 947057 | - | NZ_CP008953.1 | Amycolatopsis japonica |
| 85 | 7671340 | 7671591 | + | NC_021252.1 | Amycolatopsis keratiniphila |
| 86 | 871318 | 871617 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 87 | 3390528 | 3390818 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 88 | 2032654 | 2032941 | + | NZ_CP060713.1 | Nocardioides mesophilus |
| 89 | 648504 | 648797 | - | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 90 | 1093010 | 1093309 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 91 | 839620 | 839886 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 92 | 1291919 | 1292212 | - | NZ_AP023396.1 | Nocardia wallacei |
| 93 | 1888652 | 1888900 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 94 | 1397481 | 1397777 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 95 | 6533726 | 6534025 | + | NZ_LR134352.1 | Nocardia asteroides |
| 96 | 1653994 | 1654284 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 97 | 4505269 | 4505565 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 98 | 2549504 | 2549818 | + | NC_014666.1 | Frankia inefficax |
| 99 | 1446047 | 1446349 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 100 | 3455906 | 3456199 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 101 | 5760669 | 5760959 | + | NZ_CP016353.1 | Prauserella marina |
| 102 | 2964921 | 2965220 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 103 | 5545014 | 5545310 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 104 | 831520 | 831765 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 105 | 5034920 | 5035213 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 106 | 5976824 | 5977111 | + | NC_013729.1 | Kribbella flavida DSM 17836 |
| 107 | 902078 | 902365 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 108 | 917470 | 917757 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 109 | 8859050 | 8859322 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 110 | 890093 | 890371 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 111 | 1121632 | 1121919 | - | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 112 | 7909582 | 7909866 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 113 | 5718741 | 5719016 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 114 | 4973559 | 4973846 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 115 | 2105558 | 2105830 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 116 | 2627947 | 2628234 | + | NZ_CP043661.1 | Kribbella qitaiheensis |
| 117 | 3067819 | 3068109 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 118 | 3153880 | 3154152 | - | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 119 | 6395183 | 6395479 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 120 | 1461103 | 1461381 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 121 | 1048268 | 1048564 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 122 | 8262433 | 8262726 | - | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 123 | 656632 | 656925 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 124 | 6889149 | 6889430 | + | NZ_AP017900.1 | Nocardia seriolae |
| 125 | 821250 | 821543 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 126 | 4496095 | 4496379 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 127 | 6277344 | 6277628 | - | NZ_CP058322.1 | Micromonospora carbonacea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022617.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09594.12 | 0.78 | 99 | -22.0 | opposite-strand | Glycosyltransferase family 87 |
| 2 | PF00293.30 | 0.69 | 87 | 28 | opposite-strand | NUDIX domain |
| 3 | PF14815.8 | 0.67 | 85 | 28 | opposite-strand | NUDIX domain |
++ More..