Result : D3RW30
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 (EC 3.1.-.-) |
| NCBI Accession ID | CP001897.1 |
| Organism | Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) (Chromatium vinosum) |
| Left | 17240 |
| Right | 17524 |
| Strand | + |
| Nucleotide Sequence | ATGTCGAGCCGCTTGGCCGTATTCGCCTATGACATCCGCGATGACCGTGTGCGTCGGCACGCGCTCAAGACCCTGCGCGAATGGCGTCTCGATGGGCAGCTGTCGGTGCATGAATGTCAGGTCGACGCCATCCAGGCCCGGCGGCTGTTTGAGCAACTCGGTGATGAACTCGACCCGGCCACCGATGCCTGGCTGTTCACCTGGGTCGAAGGGCATCGCGCTGTGCTGGCCCGTGGCAAGGGTCGCACCACGGCGCTTCAGGATGGCCTGCTGCTGGCTGCCTGA |
| Sequence | MSSRLAVFAYDIRDDRVRRHALKTLREWRLDGQLSVHECQVDAIQARRLFEQLGDELDPATDAWLFTWVEGHRAVLARGKGRTTALQDGLLLAA |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
| Pubmed ID | 22675582 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | D3RW30 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 17240 | 17524 | + | NC_013852.1 | Allochromatium vinosum DSM 180 |
| 2 | 747153 | 747437 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09652.12 | 1.0 | 2 | 386.0 | same-strand | Putative CRISPR-associated protein (Cas VVA1548) |
| 2 | PF09827.11 | 1.0 | 2 | 27.0 | same-strand | CRISPR associated protein Cas2 |
| 3 | PF01867.18 | 1.0 | 2 | 396.5 | same-strand | CRISPR associated protein Cas1 |
++ More..