Result : D3RQU0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | N(2)-fixation sustaining protein CowN (CO weal-nitrogenase) |
| NCBI Accession ID | CP001896.1 |
| Organism | Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) (Chromatium vinosum) |
| Left | 3240103 |
| Right | 3240390 |
| Strand | - |
| Nucleotide Sequence | GTGTCCCAGGCTGCCGTGAAGATTGATCGCTATATCACGTTCGAGGGAATCGAGTGCGACGAGCAGGCGCGTCGCGTTCTGGACTGTATCCGTGACTGTATCGAGGCGCCCGAGGCCTCGTCCTGGAGCGCCTATTTCGAGCGCAAGCTCGATGAGATCACGCGGATGGGGCAGGACGAGCTGTTCGTCGTCGGCAGTCAGGTCAACTATATCCGCGCCCTGTTCGAGCACCACGGACACCGCGAAGGGCTGGATCTGCTCGACCGGATCGAGGACGAGTGCTGCTGA |
| Sequence | MSQAAVKIDRYITFEGIECDEQARRVLDCIRDCIEAPEASSWSAYFERKLDEITRMGQDELFVVGSQVNYIRALFEHHGHREGLDLLDRIEDECC |
| Source of smORF | Swiss-Prot |
| Function | Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. {ECO:0000255|HAMAP-Rule:MF_02117}. |
| Pubmed ID | 22675582 |
| Domain | CDD:411285 |
| Functional Category | Others |
| Uniprot ID | D3RQU0 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3240103 | 3240390 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 2 | 4179711 | 4180001 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 3 | 1650793 | 1651083 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013851.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03330.20 | 0.67 | 2 | 2592.5 | opposite-strand | Lytic transglycolase |
| 2 | PF00768.22 | 0.67 | 2 | 1364.0 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |
| 3 | PF07943.15 | 0.67 | 2 | 1364.0 | opposite-strand | Penicillin-binding protein 5, C-terminal domain |
| 4 | PF04359.16 | 0.67 | 2 | 646.5 | opposite-strand | Protein of unknown function (DUF493) |
++ More..