Result : D2NT92
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) |
| NCBI Accession ID | AP011540.1 |
| Organism | Rothia mucilaginosa (strain DY-18) (Stomatococcus mucilaginosus) |
| Left | 1134310 |
| Right | 1134504 |
| Strand | + |
| Nucleotide Sequence | ATGAGCCGCGAACGCATCAGCGCACAGCAGACCGAAACCACCGCAGCCGAGCAGGAGCAGGAACTGACCCTCGCCGCCTCCCACGTTGTCTCTGACGTGAGCGAGGTCGACGACCTGCTCGACGAAATTGACGGCCTGCTCGCTGAGAACGCTGAAGACTTCGTCACCGGCTTCGTCCAGAAGGGCGGCGAGTAA |
| Sequence | MSRERISAQQTETTAAEQEQELTLAASHVVSDVSEVDDLLDEIDGLLAENAEDFVTGFVQKGGE |
| Source of smORF | Swiss-Prot |
| Function | Protein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. {ECO:0000255|HAMAP-Rule:MF_02106}. |
| Pubmed ID | |
| Domain | CDD:391659 |
| Functional Category | Others |
| Uniprot ID | D2NT92 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1317051 | 1317245 | - | NZ_LR134479.1 | Rothia aeria |
| 2 | 2177351 | 2177551 | - | NC_014643.1 | Rothia dentocariosa ATCC 17931 |
| 3 | 1371245 | 1371445 | - | NZ_CP061539.1 | Rothia terrae |
| 4 | 1289395 | 1289592 | - | NZ_CP056080.1 | Rothia nasimurium |
| 5 | 1361110 | 1361301 | - | NZ_CP009246.1 | Corynebacterium flavescens |
| 6 | 1538249 | 1538443 | - | NZ_CP015622.1 | Corynebacterium crudilactis |
| 7 | 1308425 | 1308625 | - | NZ_CP061538.1 | Rothia amarae |
| 8 | 2646691 | 2646870 | - | NZ_CP014228.1 | Actinomyces radicidentis |
| 9 | 1868425 | 1868610 | + | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 10 | 51265 | 51447 | + | NZ_LR134476.1 | Trueperella bialowiezensis |
| 11 | 1788916 | 1789101 | + | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 12 | 957628 | 957846 | - | NZ_CP031194.1 | Streptomyces paludis |
| 13 | 808639 | 808839 | - | NZ_CP014209.1 | Isoptericola dokdonensis DS-3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134479.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13280.8 | 0.62 | 8 | 3015.0 | same-strand | WYL domain |
| 2 | PF00254.30 | 0.62 | 8 | 2526 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 3 | PF03136.17 | 1.0 | 13 | 51.0 | same-strand | Pup-ligase protein |
| 4 | PF00004.31 | 1.0 | 13 | 1683 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 5 | PF16450.7 | 1.0 | 13 | 1683 | same-strand | Proteasomal ATPase OB C-terminal domain |
| 6 | PF17758.3 | 1.0 | 13 | 1683 | same-strand | Proteasomal ATPase OB N-terminal domain |
| 7 | PF14801.8 | 0.92 | 12 | 3540.0 | same-strand | tRNA methyltransferase complex GCD14 subunit N-term |
++ More..