Result : C6E2G9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP001661.1 |
| Organism | Geobacter sp. (strain M21) |
| Left | 1236256 |
| Right | 1236447 |
| Strand | - |
| Nucleotide Sequence | ATGTCCAGAATATGCGAGATTTGCGGTAAAGGCCCTAGCTTCGGGAATAATGTCAGCCACGCTAACAACAAAACCAGCAAAATCTGGCGCCCGAACCTGCAGAAGATCAAGGCCGTTAAAAACGGTACCGTCAGGAGCATCAAGGTCTGCACCCGCTGCATCCGCTCCGGTCACGTCACCAAGGCCCTCTAG |
| Sequence | MSRICEICGKGPSFGNNVSHANNKTSKIWRPNLQKIKAVKNGTVRSIKVCTRCIRSGHVTKAL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C6E2G9 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 217
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1176413 | 1176604 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 2 | 3699566 | 3699757 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 3 | 3729871 | 3730062 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 4 | 2382681 | 2382872 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 5 | 2296892 | 2297083 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 6 | 2595584 | 2595775 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 7 | 2631537 | 2631728 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 8 | 2449918 | 2450109 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 9 | 1847036 | 1847227 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 10 | 1524820 | 1525011 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 11 | 2443775 | 2443969 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 12 | 367025 | 367213 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 13 | 1510522 | 1510713 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 14 | 1675601 | 1675798 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 15 | 2530059 | 2530250 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 16 | 93627 | 93827 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 17 | 1396935 | 1397135 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 18 | 67925 | 68119 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 19 | 590425 | 590613 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 20 | 515443 | 515655 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 21 | 6894698 | 6894889 | + | NZ_CP015136.1 | Luteitalea pratensis |
| 22 | 1970757 | 1970948 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 23 | 721284 | 721496 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 24 | 1161627 | 1161818 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 25 | 4011924 | 4012118 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 26 | 2327689 | 2327883 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 27 | 539074 | 539265 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 28 | 1617456 | 1617647 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 29 | 2370058 | 2370267 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 30 | 1723106 | 1723303 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 31 | 1758161 | 1758358 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 32 | 2236238 | 2236426 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 33 | 1509075 | 1509266 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 34 | 127051 | 127239 | - | NZ_CP042806.1 | Terriglobus albidus |
| 35 | 210188 | 210385 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 36 | 1474432 | 1474641 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 37 | 457448 | 457639 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 38 | 2615176 | 2615379 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 39 | 2859120 | 2859311 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 40 | 4458691 | 4458885 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 41 | 2729767 | 2729955 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 42 | 1505243 | 1505434 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 43 | 395950 | 396141 | - | NZ_CP061800.1 | Desulfonema magnum |
| 44 | 1282007 | 1282195 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 45 | 2762051 | 2762266 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 46 | 2259177 | 2259371 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 47 | 1129980 | 1130171 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 48 | 1394517 | 1394708 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 49 | 3400021 | 3400212 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 50 | 2726838 | 2727026 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 51 | 1884862 | 1885056 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 52 | 1815415 | 1815627 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 53 | 2859890 | 2860084 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 54 | 1519730 | 1519921 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 55 | 1335333 | 1335524 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 56 | 1115014 | 1115205 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 57 | 2126273 | 2126464 | + | NZ_CP036259.1 | Sporomusa termitida |
| 58 | 4069275 | 4069466 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 59 | 3035497 | 3035709 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 60 | 1311653 | 1311841 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 61 | 1546786 | 1546977 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 62 | 2588828 | 2589013 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 63 | 700303 | 700491 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 64 | 2368595 | 2368786 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 65 | 923699 | 923896 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 66 | 1140220 | 1140411 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 67 | 388766 | 388966 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 68 | 114294 | 114485 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 69 | 2157324 | 2157515 | + | NZ_CP009687.1 | Clostridium aceticum |
| 70 | 2506165 | 2506356 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 71 | 756705 | 756896 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 72 | 1846451 | 1846666 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 73 | 1983993 | 1984184 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 74 | 5655213 | 5655404 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 75 | 2581635 | 2581829 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 76 | 290288 | 290476 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 77 | 1229619 | 1229810 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 78 | 2789232 | 2789423 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 79 | 323349 | 323540 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 80 | 84611 | 84805 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 81 | 4079088 | 4079276 | + | NZ_CP030840.1 | Acidisarcina polymorpha |
| 82 | 2406914 | 2407105 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 83 | 1149930 | 1150121 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 84 | 330526 | 330717 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 85 | 3928090 | 3928281 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 86 | 1025625 | 1025834 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 87 | 1372361 | 1372549 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 88 | 242257 | 242454 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 89 | 1394683 | 1394907 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 90 | 1710385 | 1710576 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 91 | 530935 | 531126 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 92 | 6348770 | 6348955 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 93 | 959077 | 959268 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 94 | 986741 | 986929 | - | NZ_LR778174.1 | Veillonella parvula |
| 95 | 3602986 | 3603177 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 96 | 1366930 | 1367121 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 97 | 1418352 | 1418543 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 98 | 3038123 | 3038308 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 99 | 2582491 | 2582676 | - | NZ_LR134442.1 | Propionibacterium australiense |
| 100 | 269708 | 269899 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 101 | 2018129 | 2018320 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 102 | 1552871 | 1553029 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 103 | 1170899 | 1171090 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 104 | 5419634 | 5419825 | + | NZ_CP012109.1 | Myxococcus hansupus |
| 105 | 2325919 | 2326110 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 106 | 352843 | 353031 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 107 | 1753204 | 1753389 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 108 | 3146723 | 3146914 | - | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 109 | 4200533 | 4200724 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 110 | 3137974 | 3138165 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 111 | 6043867 | 6044052 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 112 | 951721 | 951909 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 113 | 1032253 | 1032444 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 114 | 4129354 | 4129545 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 115 | 1187869 | 1188060 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 116 | 1642582 | 1642779 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 117 | 1964666 | 1964854 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 118 | 575850 | 576047 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 119 | 1163415 | 1163606 | - | NZ_CP020953.1 | Clostridium drakei |
| 120 | 124579 | 124770 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 121 | 3427227 | 3427418 | + | NZ_LT828648.1 | Nitrospira japonica |
| 122 | 1353011 | 1353202 | + | NZ_CP061799.1 | Desulfonema limicola |
| 123 | 4957562 | 4957747 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 124 | 6725459 | 6725650 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 125 | 3104614 | 3104805 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 126 | 1458019 | 1458210 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 127 | 2009884 | 2010084 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 128 | 786207 | 786398 | - | NZ_LT821227.1 | Phoenicibacter congonensis |
| 129 | 1495687 | 1495872 | + | NC_020990.1 | Streptomyces albidoflavus |
| 130 | 1874723 | 1874908 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 131 | 2441646 | 2441867 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 132 | 430164 | 430376 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 133 | 1882902 | 1883093 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 134 | 518100 | 518291 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 135 | 1829294 | 1829485 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 136 | 3290355 | 3290546 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 137 | 4078588 | 4078779 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 138 | 5917357 | 5917542 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 139 | 1795254 | 1795445 | + | NZ_CP048649.1 | Aminipila butyrica |
| 140 | 2055762 | 2055953 | - | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 141 | 3146240 | 3146431 | - | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 142 | 3301170 | 3301364 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 143 | 862714 | 862872 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 144 | 2986008 | 2986229 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 145 | 2578313 | 2578501 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 146 | 966648 | 966839 | + | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 147 | 2928183 | 2928374 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 148 | 2067166 | 2067351 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 149 | 728242 | 728433 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 150 | 617399 | 617605 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 151 | 4515650 | 4515856 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 152 | 2307801 | 2308022 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 153 | 960262 | 960453 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 154 | 2273719 | 2273910 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 155 | 3141693 | 3141878 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 156 | 2234796 | 2234987 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 157 | 694167 | 694361 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 158 | 1639017 | 1639202 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 159 | 2269014 | 2269199 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 160 | 4771426 | 4771611 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 161 | 2154351 | 2154542 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 162 | 2960011 | 2960202 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 163 | 6480424 | 6480609 | - | NZ_CP027306.1 | Streptomyces atratus |
| 164 | 1437234 | 1437443 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 165 | 1143218 | 1143406 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 166 | 6051405 | 6051590 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 167 | 871920 | 872108 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 168 | 1483867 | 1484052 | - | NC_012115.1 | Nautilia profundicola AmH |
| 169 | 6137382 | 6137567 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 170 | 2162608 | 2162796 | - | NZ_CP019962.1 | Eubacterium limosum |
| 171 | 789975 | 790184 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 172 | 3919171 | 3919359 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 173 | 2135153 | 2135344 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 174 | 152358 | 152543 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 175 | 1327923 | 1328108 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 176 | 5986779 | 5986964 | - | NZ_CP070242.1 | Streptomyces californicus |
| 177 | 4826656 | 4826844 | + | NZ_CP034437.1 | Paenibacillus albus |
| 178 | 294236 | 294415 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 179 | 5855801 | 5855986 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 180 | 5992393 | 5992578 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 181 | 3628791 | 3629000 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 182 | 690718 | 690897 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 183 | 1397278 | 1397457 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 184 | 468027 | 468203 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 185 | 1843116 | 1843313 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 186 | 4258416 | 4258604 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 187 | 379359 | 379544 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 188 | 562723 | 562905 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 189 | 1983042 | 1983224 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 190 | 2132497 | 2132679 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 191 | 2078974 | 2079156 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 192 | 421990 | 422172 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 193 | 2327056 | 2327238 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 194 | 6455081 | 6455269 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 195 | 615129 | 615311 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 196 | 818430 | 818624 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 197 | 943920 | 944114 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 198 | 1919375 | 1919560 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 199 | 960336 | 960530 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 200 | 983037 | 983231 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 201 | 1018906 | 1019100 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 202 | 1074501 | 1074695 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 203 | 6431406 | 6431594 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 204 | 1067561 | 1067737 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 205 | 1455966 | 1456157 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 206 | 392132 | 392326 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 207 | 1265235 | 1265426 | + | NZ_CP053826.1 | Campylobacter curvus |
| 208 | 1303716 | 1303907 | - | NZ_CP012544.1 | Campylobacter showae |
| 209 | 853778 | 853972 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 210 | 731504 | 731695 | - | NZ_CP012541.1 | Campylobacter concisus |
| 211 | 828321 | 828512 | + | NZ_CP012543.1 | Campylobacter rectus |
| 212 | 291868 | 292077 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 213 | 1677611 | 1677799 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 214 | 301482 | 301673 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 215 | 1158443 | 1158634 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 216 | 1031393 | 1031584 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 217 | 723422 | 723610 | + | NZ_CP021886.1 | Helicobacter apodemus |
++ More..