Result : A1U7J5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | CP000514.1 |
| Organism | Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) |
| Left | 4325830 |
| Right | 4326123 |
| Strand | - |
| Nucleotide Sequence | ATGCGTCAACTCCTGCTCTTGCCCATCCGGTTCTACCAGTATGCCATCAGTCCGATGATGGCCAGCCATTGCCGTCATTACCCTACCTGTTCACAATACGCCGTCGAGGCCATCCAACATCACGGACCTCTTAAAGGCGGTTACCTGGCAACAGCCCGGCTACTCAGGTGTCATCCCTGGGCAGAAGGCGGTTATGATCCGGTACCGGGAACGGAACTGAATACGGCGCCTCGCTCCGGCCAGGCCTGCAATCCGACAGAAAGCACTCATTCCACTACTCAGACCAGACACTAA |
| Sequence | MRQLLLLPIRFYQYAISPMMASHCRHYPTCSQYAVEAIQHHGPLKGGYLATARLLRCHPWAEGGYDPVPGTELNTAPRSGQACNPTESTHSTTQTRH |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | A1U7J5 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3904501 | 3904794 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
| 2 | 3289160 | 3289453 | + | NZ_CP017715.1 | Marinobacter salinus |
| 3 | 219593 | 219886 | + | NZ_CP020931.1 | Marinobacter salarius |
| 4 | 4542239 | 4542523 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 5 | 2300860 | 2301111 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 6 | 3948144 | 3948386 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 7 | 6182343 | 6182588 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 8 | 4180326 | 4180589 | - | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 9 | 605878 | 606126 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 10 | 6094175 | 6094423 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 11 | 1965672 | 1965932 | - | NZ_CP034348.1 | Roseovarius faecimaris |
| 12 | 5965712 | 5965972 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 13 | 2442168 | 2442437 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 14 | 3895217 | 3895477 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 15 | 6372224 | 6372484 | - | NZ_CP048832.1 | Janthinobacterium lividum |
| 16 | 6273005 | 6273265 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 17 | 1186687 | 1186935 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 18 | 3668722 | 3668997 | + | NZ_CP043146.1 | Bordetella holmesii |
| 19 | 1304813 | 1305070 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 20 | 2419811 | 2420071 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 21 | 31338 | 31598 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 22 | 1579371 | 1579637 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 23 | 1246092 | 1246352 | + | NZ_AP019736.1 | Alistipes dispar |
| 24 | 679484 | 679723 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 25 | 1779664 | 1779906 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 26 | 1071 | 1370 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 27 | 652569 | 652808 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 28 | 3702177 | 3702443 | - | NZ_CP013459.1 | Burkholderia stagnalis |
| 29 | 3555238 | 3555504 | - | NZ_CP013401.1 | Burkholderia metallica |
| 30 | 3587474 | 3587740 | - | NZ_CP013450.1 | Burkholderia cenocepacia |
| 31 | 566159 | 566425 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 32 | 3692828 | 3693094 | - | NC_007510.1 | Burkholderia lata |
| 33 | 3503843 | 3504109 | - | NZ_CP013398.1 | Burkholderia seminalis |
| 34 | 3686695 | 3686961 | - | NZ_CP045235.1 | Burkholderia cepacia |
| 35 | 3735761 | 3736027 | - | NZ_CP020737.1 | Paraburkholderia acidophila |
| 36 | 4821722 | 4821982 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 37 | 287412 | 287669 | + | NZ_CP018787.1 | Oxalobacter formigenes |
| 38 | 1015278 | 1015529 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 39 | 4690685 | 4690942 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 40 | 2528213 | 2528485 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 41 | 158485 | 158721 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 42 | 4653160 | 4653423 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 43 | 1325138 | 1325383 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 44 | 1339337 | 1339582 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 45 | 1348763 | 1349008 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 46 | 1021940 | 1022176 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017506.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.74 | 34 | 8.0 | same-strand | 60Kd inner membrane protein |
++ More..