Result : A0A0K2G9F6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prokaryotic ubiquitin-like protein UBact |
| NCBI Accession ID | CP011801.1 |
| Organism | Nitrospira moscoviensis |
| Left | 760921 |
| Right | 761121 |
| Strand | + |
| Nucleotide Sequence | ATGAACATGAGATATACGCTCATGCCCGAGCGCCGCGAAGGGCCGGTCGATCCGATGCCCCAGTCACCGTCGCCGTCGGACGAAGGCGGCGGACCCAGGAGGCCGGAGACCGGGTCGCCGGATAAAGACAATTTGCTGAAGCGGATGCGGAAGGTGGATCCGAAACAAGCTGAGCGGTATCGGCAGAGGACGGGGGAGTAG |
| Sequence | MNMRYTLMPERREGPVDPMPQSPSPSDEGGGPRRPETGSPDKDNLLKRMRKVDPKQAERYRQRTGE |
| Source of smORF | Swiss-Prot |
| Function | May function as a protein modifier covalently attached to lysine residues of substrate proteins. This may serve to target the modified proteins for degradation by proteasomes. {ECO:0000305|Pubmed:28087277}. |
| Pubmed ID | 26305944 28087277 |
| Domain | CDD:380238 |
| Functional Category | Others |
| Uniprot ID | A0A0K2G9F6 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 760921 | 761121 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 2 | 1882421 | 1882615 | + | NZ_LT828648.1 | Nitrospira japonica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011801.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01894.19 | 1.0 | 2 | 4528.5 | same-strand | Uncharacterised protein family UPF0047 |
| 2 | PF13365.8 | 1.0 | 2 | 3409.5 | same-strand | Trypsin-like peptidase domain |
| 3 | PF13180.8 | 1.0 | 2 | 3409.5 | same-strand | PDZ domain |
| 4 | PF00089.28 | 1.0 | 2 | 3409.5 | same-strand | Trypsin |
| 5 | PF00595.26 | 1.0 | 2 | 3409.5 | same-strand | PDZ domain |
| 6 | PF00004.31 | 1.0 | 2 | 1542.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF17758.3 | 1.0 | 2 | 1542.5 | same-strand | Proteasomal ATPase OB N-terminal domain |
| 8 | PF16450.7 | 1.0 | 2 | 1542.5 | same-strand | Proteasomal ATPase OB C-terminal domain |
| 9 | PF03136.17 | 1.0 | 2 | 837.0 | same-strand | Pup-ligase protein |
| 10 | PF00227.28 | 1.0 | 2 | 490.5 | same-strand | Proteasome subunit |
| 11 | PF00561.22 | 1.0 | 2 | 3497.0 | opposite-strand | alpha/beta hydrolase fold |
| 12 | PF12697.9 | 1.0 | 2 | 3497.0 | opposite-strand | Alpha/beta hydrolase family |
++ More..