Result : C6DG83
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein TusB (tRNA 2-thiouridine synthesizing protein B) |
| NCBI Accession ID | CP001657.1 |
| Organism | Pectobacterium carotovorum subsp. carotovorum (strain PC1) |
| Left | 4314116 |
| Right | 4314403 |
| Strand | - |
| Nucleotide Sequence | ATGCTGCATACGCTCTCATGTTCCCCTTATCACGCTGACCTGGATACGCTGTTGCGTGGACTGGACAAAGGTGACGCTTTAGTCTTATTGCAAGATGGTGTTATCGCTGCTCTGGCTGGTGGAAACATTATCCATCGTCTTCTTGATTCCGCGGTTCCGCTCTACGCGCTTCGGCCTGATGTCGTAGCGAGAGGAATGACTGAACAAATTTCAAACAGTGCAGTGCTCATTGGCTATAATGAATTTGTTCAACTGACAGTGGAGCACCCGCAGCAACTCGCGTGGTAA |
| Sequence | MLHTLSCSPYHADLDTLLRGLDKGDALVLLQDGVIAALAGGNIIHRLLDSAVPLYALRPDVVARGMTEQISNSAVLIGYNEFVQLTVEHPQQLAW |
| Source of smORF | Swiss-Prot |
| Function | Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. {ECO:0000255|HAMAP-Rule:MF_01564}. |
| Pubmed ID | |
| Domain | CDD:412512 |
| Functional Category | Others |
| Uniprot ID | C6DG83 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 66
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 511628 | 511915 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 2 | 4412771 | 4413058 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 3 | 1144497 | 1144784 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 4 | 4726847 | 4727134 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 5 | 2128802 | 2129089 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 6 | 470581 | 470868 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 7 | 4242871 | 4243158 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 8 | 3216113 | 3216400 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 9 | 4403307 | 4403594 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 10 | 478612 | 478899 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 11 | 142323 | 142610 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 12 | 4790431 | 4790718 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 13 | 369823 | 370110 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 14 | 466568 | 466855 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 15 | 4197653 | 4197940 | - | NZ_CP025799.1 | Dickeya zeae |
| 16 | 4434431 | 4434718 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 17 | 1654269 | 1654556 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 18 | 3308274 | 3308561 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 19 | 444512 | 444799 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 20 | 757408 | 757695 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 21 | 4728211 | 4728498 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 22 | 4397563 | 4397850 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 23 | 308686 | 308973 | + | NZ_CP065534.1 | Lonsdalea populi |
| 24 | 3474678 | 3474965 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 25 | 496450 | 496737 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 26 | 4389179 | 4389466 | - | NZ_CP032487.1 | Yersinia hibernica |
| 27 | 423281 | 423568 | + | NZ_CP054254.1 | Klebsiella variicola |
| 28 | 970143 | 970430 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 29 | 413743 | 414030 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 30 | 325767 | 326054 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 31 | 307256 | 307543 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 32 | 3537933 | 3538220 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 33 | 417558 | 417845 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 34 | 2996822 | 2997109 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 35 | 4187204 | 4187491 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 36 | 4217665 | 4217952 | + | NZ_CP028271.1 | Mixta intestinalis |
| 37 | 3491302 | 3491589 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 38 | 4877202 | 4877489 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 39 | 4375081 | 4375368 | - | NZ_CP043727.1 | Yersinia canariae |
| 40 | 2380862 | 2381149 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 41 | 301100 | 301387 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 42 | 1274836 | 1275123 | - | NZ_CP007230.1 | Yersinia similis |
| 43 | 365876 | 366163 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 44 | 4194712 | 4194999 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 45 | 457821 | 458108 | + | NZ_CP038853.1 | Pantoea vagans |
| 46 | 442789 | 443076 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 47 | 4881179 | 4881466 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 48 | 4053832 | 4054122 | - | NZ_LT615367.1 | Dickeya aquatica |
| 49 | 412710 | 412997 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 50 | 447685 | 447972 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 51 | 468689 | 468976 | + | NZ_CP026377.1 | Mixta gaviniae |
| 52 | 2892481 | 2892768 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 53 | 3550434 | 3550721 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 54 | 4817210 | 4817497 | - | NZ_LT906479.1 | Serratia ficaria |
| 55 | 1125926 | 1126210 | - | NZ_CP065640.1 | Serratia rubidaea |
| 56 | 3897915 | 3898202 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 57 | 1375593 | 1375880 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 58 | 397153 | 397440 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 59 | 4852912 | 4853199 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 60 | 4081011 | 4081298 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 61 | 722352 | 722639 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 62 | 1325729 | 1326016 | - | NZ_CP011254.1 | Serratia fonticola |
| 63 | 3623597 | 3623884 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 64 | 452678 | 452965 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 65 | 414338 | 414625 | + | NZ_CP041247.1 | Raoultella electrica |
| 66 | 415900 | 416187 | + | NZ_CP050508.1 | Raoultella terrigena |
| 67 | 2004665 | 2004955 | + | NZ_CP023706.1 | Edwardsiella tarda |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034036.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08348.13 | 1.0 | 66 | 769 | same-strand | YheO-like PAS domain |
| 2 | PF13309.8 | 1.0 | 66 | 768 | same-strand | HTH domain |
| 3 | PF13384.8 | 0.94 | 62 | 769 | same-strand | Homeodomain-like domain |
| 4 | PF02635.17 | 1.0 | 66 | 367 | same-strand | DsrE/DsrF-like family |
| 5 | PF00164.27 | 1.0 | 66 | 132 | same-strand | Ribosomal protein S12/S23 |
| 6 | PF00177.23 | 1.0 | 66 | 603 | same-strand | Ribosomal protein S7p/S5e |
| 7 | PF00009.29 | 1.0 | 66 | 2270.5 | same-strand | Elongation factor Tu GTP binding domain |
| 8 | PF03764.20 | 1.0 | 66 | 1166 | same-strand | Elongation factor G, domain IV |
| 9 | PF14492.8 | 1.0 | 66 | 1166 | same-strand | Elongation Factor G, domain III |
| 10 | PF00679.26 | 1.0 | 66 | 1166 | same-strand | Elongation factor G C-terminus |
| 11 | PF03144.27 | 1.0 | 66 | 2270.5 | same-strand | Elongation factor Tu domain 2 |
| 12 | PF03143.19 | 1.0 | 66 | 3350 | same-strand | Elongation factor Tu C-terminal domain |
| 13 | PF01926.25 | 1.0 | 66 | 3350 | same-strand | 50S ribosome-binding GTPase |
| 14 | PF04324.17 | 0.86 | 57 | 4705 | same-strand | BFD-like [2Fe-2S] binding domain |
| 15 | PF04102.14 | 0.7 | 46 | 2801 | opposite-strand | SlyX |
| 16 | PF00254.30 | 0.71 | 47 | 1680.0 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 17 | PF01346.20 | 0.71 | 47 | 1680.0 | same-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
++ More..