Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP001649.1 |
Organism | Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) |
Left | 818147 |
Right | 818389 |
Strand | + |
Nucleotide Sequence | TTGACAAAAGACAATAAAACATTTGAAGACCGTCTTGACCGCTTGAAGGCGATAGTGTCTGCCCTTGAAAAGGGCGACCTGCCCCTTGAGGAAGGTGTGGCCCTGTTTAAAGAAGGCCAGACCCTTTCCAAGGAATGCGCCACACAGCTGGAAAAGGCCCGTAATGAAGTTAAAATAGTCACTGGCGGCGAAGTTGAAGACTTTGACGTTGATACAGAAGAGGATACAGCGGATGACAGTTAA |
Sequence | MTKDNKTFEDRLDRLKAIVSALEKGDLPLEEGVALFKEGQTLSKECATQLEKARNEVKIVTGGEVEDFDVDTEEDTADDS |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | C6BYY0 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 818147 | 818389 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
2 | 3353709 | 3353903 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
3 | 2872306 | 2872542 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
4 | 597000 | 597227 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
5 | 1371622 | 1371840 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
6 | 498829 | 499098 | + | NC_020127.1 | Lawsonia intracellularis N343 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04551.16 | 0.67 | 4 | 4386.5 | same-strand | GcpE protein |
2 | PF00587.27 | 0.83 | 5 | 2671 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
3 | PF04073.17 | 0.83 | 5 | 2671 | same-strand | Aminoacyl-tRNA editing domain |
4 | PF03129.22 | 0.83 | 5 | 2671 | same-strand | Anticodon binding domain |
5 | PF02601.17 | 1.0 | 6 | 1037.0 | same-strand | Exonuclease VII, large subunit |
6 | PF13742.8 | 1.0 | 6 | 1037.0 | same-strand | OB-fold nucleic acid binding domain |
7 | PF01551.24 | 1.0 | 6 | 88 | same-strand | Peptidase family M23 |
8 | PF00348.19 | 1.0 | 6 | -5.0 | same-strand | Polyprenyl synthetase |
9 | PF13292.8 | 1.0 | 6 | 928.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
10 | PF02779.26 | 1.0 | 6 | 928.0 | same-strand | Transketolase, pyrimidine binding domain |
11 | PF02780.22 | 1.0 | 6 | 928.0 | same-strand | Transketolase, C-terminal domain |
12 | PF01336.27 | 0.67 | 4 | 1034.5 | same-strand | OB-fold nucleic acid binding domain |