Result : C6BYY0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP001649.1 |
| Organism | Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) |
| Left | 818147 |
| Right | 818389 |
| Strand | + |
| Nucleotide Sequence | TTGACAAAAGACAATAAAACATTTGAAGACCGTCTTGACCGCTTGAAGGCGATAGTGTCTGCCCTTGAAAAGGGCGACCTGCCCCTTGAGGAAGGTGTGGCCCTGTTTAAAGAAGGCCAGACCCTTTCCAAGGAATGCGCCACACAGCTGGAAAAGGCCCGTAATGAAGTTAAAATAGTCACTGGCGGCGAAGTTGAAGACTTTGACGTTGATACAGAAGAGGATACAGCGGATGACAGTTAA |
| Sequence | MTKDNKTFEDRLDRLKAIVSALEKGDLPLEEGVALFKEGQTLSKECATQLEKARNEVKIVTGGEVEDFDVDTEEDTADDS |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | C6BYY0 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 818147 | 818389 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 2 | 3353709 | 3353903 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 3 | 2872306 | 2872542 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 4 | 597000 | 597227 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 5 | 1371622 | 1371840 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 6 | 498829 | 499098 | + | NC_020127.1 | Lawsonia intracellularis N343 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT907975.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04551.16 | 0.67 | 4 | 4386.5 | same-strand | GcpE protein |
| 2 | PF00587.27 | 0.83 | 5 | 2671 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 3 | PF04073.17 | 0.83 | 5 | 2671 | same-strand | Aminoacyl-tRNA editing domain |
| 4 | PF03129.22 | 0.83 | 5 | 2671 | same-strand | Anticodon binding domain |
| 5 | PF02601.17 | 1.0 | 6 | 1037.0 | same-strand | Exonuclease VII, large subunit |
| 6 | PF13742.8 | 1.0 | 6 | 1037.0 | same-strand | OB-fold nucleic acid binding domain |
| 7 | PF01551.24 | 1.0 | 6 | 88 | same-strand | Peptidase family M23 |
| 8 | PF00348.19 | 1.0 | 6 | -5.0 | same-strand | Polyprenyl synthetase |
| 9 | PF13292.8 | 1.0 | 6 | 928.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 10 | PF02779.26 | 1.0 | 6 | 928.0 | same-strand | Transketolase, pyrimidine binding domain |
| 11 | PF02780.22 | 1.0 | 6 | 928.0 | same-strand | Transketolase, C-terminal domain |
| 12 | PF01336.27 | 0.67 | 4 | 1034.5 | same-strand | OB-fold nucleic acid binding domain |
++ More..