Protein name |
Flagellar transcriptional regulator FlhD |
NCBI Accession ID |
CP001647.1 |
Organism |
Ralstonia pickettii (strain 12D) |
Left |
78288 |
Right |
78590 |
Strand |
- |
Nucleotide Sequence |
ATGGAAGCGACATCGCTGCTGAGCGAGATTCGATCTCTCAATATCGCGTATCTGCGCCTTGCTCGCAGGCTGCTAGCCACCGATCAAGCCCTGGCGACAACTGCGCTGGGTATCTCTCAATCGATGGGCGAGGCATTGCTGACCCTCGACGAAGAGGCATGCGTGCGCATGGCACAGACCAATCTGTTTTTGTGCCGCATCCACTTTGATGATCGGGTGCTCGCTGCGCTGTTGGCTGGACCTCGCCTGGAGCTGTTGGAAAGCCCTGCCTCGGCGGGCAAGGCGGCCCCCGCGATTGCGTGA |
Sequence |
MEATSLLSEIRSLNIAYLRLARRLLATDQALATTALGISQSMGEALLTLDEEACVRMAQTNLFLCRIHFDDRVLAALLAGPRLELLESPASAGKAAPAIA |
Source of smORF |
Swiss-Prot |
Function |
Functions in complex with FlhC as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways. {ECO:0000255|HAMAP-Rule:MF_00725}. |
Pubmed ID |
|
Domain |
|
Functional Category |
DNA-binding |
Uniprot ID |
C6BQP8
|
ORF Length (Amino Acid) |
100 |