| Protein name |
Flagellar transcriptional regulator FlhD |
| NCBI Accession ID |
CP001647.1 |
| Organism |
Ralstonia pickettii (strain 12D) |
| Left |
78288 |
| Right |
78590 |
| Strand |
- |
| Nucleotide Sequence |
ATGGAAGCGACATCGCTGCTGAGCGAGATTCGATCTCTCAATATCGCGTATCTGCGCCTTGCTCGCAGGCTGCTAGCCACCGATCAAGCCCTGGCGACAACTGCGCTGGGTATCTCTCAATCGATGGGCGAGGCATTGCTGACCCTCGACGAAGAGGCATGCGTGCGCATGGCACAGACCAATCTGTTTTTGTGCCGCATCCACTTTGATGATCGGGTGCTCGCTGCGCTGTTGGCTGGACCTCGCCTGGAGCTGTTGGAAAGCCCTGCCTCGGCGGGCAAGGCGGCCCCCGCGATTGCGTGA |
| Sequence |
MEATSLLSEIRSLNIAYLRLARRLLATDQALATTALGISQSMGEALLTLDEEACVRMAQTNLFLCRIHFDDRVLAALLAGPRLELLESPASAGKAAPAIA |
| Source of smORF |
Swiss-Prot |
| Function |
Functions in complex with FlhC as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways. {ECO:0000255|HAMAP-Rule:MF_00725}. |
| Pubmed ID |
|
| Domain |
|
| Functional Category |
DNA-binding |
| Uniprot ID |
C6BQP8
|
| ORF Length (Amino Acid) |
100 |