Result : C5D5S3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein K (SASP K) |
| NCBI Accession ID | CP001638.1 |
| Organism | Geobacillus sp. (strain WCH70) |
| Left | 512605 |
| Right | 512766 |
| Strand | - |
| Nucleotide Sequence | ATGCGGAATAAAGAACGCAACTTCCCAAACCAAAACAATAATAAATTCGAAGGTGAACCACGAGCGAAAGCGGAATATGCTTCAAAACGGGCAAACGGCACGACTAACACCCATCCGCAAGAACGCATGCACGCTTCCGGTAAACGCGATGACAATTTTTAA |
| Sequence | MRNKERNFPNQNNNKFEGEPRAKAEYASKRANGTTNTHPQERMHASGKRDDNF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23915. Profile Description: Small acid-soluble spore protein K family. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. It is a minor SASP (small, acid-soluble spore protein) designated SspK. [Cellular processes, Sporulation and germination] |
| Pubmed ID | |
| Domain | CDD:329168 |
| Functional Category | Others |
| Uniprot ID | C5D5S3 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 42109 | 42270 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 2 | 1199559 | 1199720 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 3 | 3640884 | 3641045 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 4 | 3446163 | 3446324 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 5 | 585408 | 585572 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 6 | 496376 | 496537 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 7 | 3199688 | 3199849 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 8 | 1768719 | 1768880 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 9 | 353309 | 353476 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 10 | 1364204 | 1364374 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 11 | 3524375 | 3524539 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 12 | 851238 | 851393 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 13 | 720182 | 720349 | - | NZ_CP012024.1 | Bacillus smithii |
| 14 | 824982 | 825152 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 15 | 390823 | 390978 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 16 | 1002332 | 1002505 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 17 | 944884 | 945033 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 18 | 981731 | 981880 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 19 | 3092644 | 3092796 | + | NZ_CP011937.1 | Bacillus velezensis |
| 20 | 852503 | 852655 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 21 | 897944 | 898093 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 22 | 3223781 | 3223942 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 23 | 3111544 | 3111714 | + | NZ_LS483476.1 | Lederbergia lentus |
| 24 | 2105436 | 2105591 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 25 | 502048 | 502206 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 26 | 1861198 | 1861353 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 27 | 909853 | 910005 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 28 | 928112 | 928264 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 29 | 791529 | 791678 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 30 | 1423030 | 1423188 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 31 | 862365 | 862517 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 32 | 659404 | 659574 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 33 | 898918 | 899070 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 34 | 1109722 | 1109874 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 35 | 1070896 | 1071048 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 36 | 918556 | 918708 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 37 | 1113557 | 1113724 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 38 | 836965 | 837114 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 39 | 664178 | 664327 | + | NZ_CP043404.1 | Bacillus safensis |
| 40 | 1025298 | 1025447 | - | NZ_CP053989.1 | Niallia circulans |
| 41 | 3177295 | 3177435 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 42 | 1072737 | 1072901 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 43 | 687873 | 688022 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 44 | 483044 | 483199 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 45 | 497781 | 497939 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 46 | 997746 | 997889 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 47 | 745236 | 745388 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP070511.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04307.16 | 0.7 | 33 | 422 | same-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 2 | PF14043.8 | 0.74 | 35 | 122 | opposite-strand | WVELL protein |
| 3 | PF08838.12 | 0.98 | 46 | 267.5 | opposite-strand | Protein of unknown function (DUF1811) |
| 4 | PF02631.18 | 1.0 | 47 | 1063 | opposite-strand | RecX family |
| 5 | PF08338.13 | 0.7 | 33 | 2151 | same-strand | Domain of unknown function (DUF1731) |
| 6 | PF01370.23 | 0.64 | 30 | 2047.0 | same-strand | NAD dependent epimerase/dehydratase family |
++ More..