Result : C5D2I2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein N (SASP N) |
| NCBI Accession ID | CP001638.1 |
| Organism | Geobacillus sp. (strain WCH70) |
| Left | 1942296 |
| Right | 1942439 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAATCCGAGGGGAAACCCAAAATATTTCAATCCGAACCATCTAGGCACCCAACCTCGTGCCGCTGGAGGAAATAAAGGGAAAAAAATGCAAGATCAATCTGGGCAACATGCTCAAGTGATTCAAACAAAAGGCGAATAA |
| Sequence | MSNPRGNPKYFNPNHLGTQPRAAGGNKGKKMQDQSGQHAQVIQTKGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl27883. Profile Description: Small acid-soluble spore protein N family. acid-soluble spore protein N; Provisional |
| Pubmed ID | |
| Domain | CDD:332704 |
| Functional Category | Others |
| Uniprot ID | C5D2I2 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1961906 | 1962049 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 2 | 2871451 | 2871594 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 3 | 1498709 | 1498852 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 4 | 1078219 | 1078362 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 5 | 2341408 | 2341551 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 6 | 1599598 | 1599741 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 7 | 777182 | 777325 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 8 | 1782946 | 1783089 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 9 | 1687942 | 1688085 | - | NZ_CP012024.1 | Bacillus smithii |
| 10 | 1778931 | 1779074 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 11 | 374881 | 375024 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 12 | 1882964 | 1883107 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 13 | 2065767 | 2065910 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 14 | 1026444 | 1026587 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 15 | 2432383 | 2432535 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 16 | 2621227 | 2621370 | + | NZ_CP053989.1 | Niallia circulans |
| 17 | 1445185 | 1445328 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 18 | 4999856 | 4999999 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 19 | 153086 | 153229 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 20 | 2525069 | 2525212 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 21 | 2185185 | 2185328 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 22 | 2289670 | 2289813 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 23 | 4401095 | 4401238 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 24 | 4622667 | 4622810 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 25 | 2167642 | 2167785 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 26 | 3059017 | 3059160 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 27 | 1772207 | 1772341 | + | NZ_CP040336.1 | Bacillus luti |
| 28 | 3375803 | 3375937 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 29 | 3426110 | 3426244 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 30 | 3637157 | 3637291 | - | NC_011725.1 | Bacillus cereus B4264 |
| 31 | 3554375 | 3554509 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 32 | 2352777 | 2352911 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 33 | 1892344 | 1892490 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 34 | 1930264 | 1930410 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 35 | 1894150 | 1894296 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 36 | 1838577 | 1838723 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 37 | 1857471 | 1857617 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 38 | 39982 | 40128 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 39 | 2076370 | 2076516 | - | NZ_CP011937.1 | Bacillus velezensis |
| 40 | 1879315 | 1879461 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP070511.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00578.23 | 0.95 | 38 | 320.5 | same-strand | AhpC/TSA family |
| 2 | PF08534.12 | 0.95 | 38 | 320.5 | same-strand | Redoxin |
| 3 | PF13905.8 | 0.95 | 38 | 320.5 | same-strand | Thioredoxin-like |
| 4 | PF13098.8 | 0.93 | 37 | 320 | same-strand | Thioredoxin-like domain |
| 5 | PF13040.8 | 0.97 | 39 | 61 | same-strand | Fur-regulated basic protein B |
| 6 | PF19824.1 | 0.85 | 34 | 50.0 | same-strand | Small, acid-soluble spore protein Tlp |
| 7 | PF03061.24 | 0.97 | 39 | 683.5 | same-strand | Thioesterase superfamily |
| 8 | PF13279.8 | 0.97 | 39 | 463 | same-strand | Thioesterase-like superfamily |
| 9 | PF01521.22 | 0.7 | 28 | 1563.0 | opposite-strand | Iron-sulphur cluster biosynthesis |
++ More..