| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SlyX homolog |
| NCBI Accession ID | CP000514.1 |
| Organism | Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) |
| Left | 2858565 |
| Right | 2858783 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAAAAACTCCCTGGAAGAACGACTGGCAGAACTGGAAATGCGACTTGCGTTCCAGGATGAGCTGATCAACACGTTGAGTGATCAGGTCGCCAAGCAGGAGATGGACATTCGGGAACTGTGGGACGCCAAGAAAATGCTGCACAAGCAACTCAAGGATATCTCGCCGTCCAATATCCGGCGGGAAGAAGAGGAAACACCCCCGCCGCATTATTGA |
| Sequence | MSKNSLEERLAELEMRLAFQDELINTLSDQVAKQEMDIRELWDAKKMLHKQLKDISPSNIRREEEETPPPHY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412736 |
| Functional Category | Others |
| Uniprot ID | A1U3R1 |
| ORF Length (Amino Acid) | 72 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1191210 | 1191428 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 2 | 1878527 | 1878745 | - | NZ_CP017715.1 | Marinobacter salinus |
| 3 | 3026320 | 3026538 | - | NZ_CP020931.1 | Marinobacter salarius |
| 4 | 2927085 | 2927303 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 5 | 1343453 | 1343671 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 6 | 3446932 | 3447135 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 362351 | 362554 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 3477655 | 3477858 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 9 | 4197689 | 4197892 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 10 | 3965737 | 3965940 | + | NZ_LR134340.1 | Escherichia marmotae |
| 11 | 2383838 | 2384041 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 12 | 3438559 | 3438762 | + | NZ_AP014857.1 | Escherichia albertii |