Result : C5CGR2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP001634.1 |
| Organism | Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1) |
| Left | 2022490 |
| Right | 2022792 |
| Strand | - |
| Nucleotide Sequence | ATGGCTAATCCTAAACTTACTCTTAACGATGTCCTTATAAGGCCAATAATAACGGAGAAGTCTTTCTCCGGAGAAGAATACAACAAGTACACCTTTGAAGTTCACAGGGATGCCAGCAAGCACCTCATAAAAGAAGCCATTGAAAAGATCTTCAATGTTAAGGTAGAAAAGATCAATGTCATAAACGTTAAGCCCAAACCAAAAAGAAGAGGTATCGCTGTTGGCAGAACGAGATCCTGGAAAAAAGCTGTGGTAACACTCGTAGAAGGTTACCGAATAAAAGAACTTGAAGGGCAACACTGA |
| Sequence | MANPKLTLNDVLIRPIITEKSFSGEEYNKYTFEVHRDASKHLIKEAIEKIFNVKVEKINVINVKPKPKRRGIAVGRTRSWKKAVVTLVEGYRIKELEGQH |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C5CGR2 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 213
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2022490 | 2022792 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 2 | 1869840 | 1870142 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 3 | 359432 | 359731 | - | NZ_LS974202.1 | Mesotoga infera |
| 4 | 731547 | 731804 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 5 | 728698 | 729000 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 6 | 1327527 | 1327829 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 7 | 1303923 | 1304225 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 8 | 984141 | 984443 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 9 | 1318110 | 1318412 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 10 | 1693241 | 1693543 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 11 | 1237131 | 1237436 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 12 | 809707 | 810009 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 13 | 990059 | 990364 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 14 | 610560 | 610862 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 15 | 603723 | 604025 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 16 | 1668113 | 1668415 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 17 | 471240 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 18 | 666584 | 666880 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 19 | 874574 | 874873 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 20 | 173125 | 173394 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 21 | 3679500 | 3679763 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 22 | 1223454 | 1223729 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 23 | 828432 | 828728 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 24 | 699011 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 25 | 92718 | 92975 | - | NZ_AP019551.1 | Athalassotoga saccharophila |
| 26 | 1933067 | 1933354 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 27 | 2167085 | 2167372 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 28 | 1491052 | 1491300 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 29 | 1448892 | 1449140 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 30 | 1222271 | 1222516 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 31 | 1156579 | 1156875 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 32 | 1711722 | 1712009 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 33 | 1136707 | 1136994 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 34 | 817743 | 818030 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 35 | 2936476 | 2936760 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 36 | 1709173 | 1709457 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 37 | 221369 | 221650 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 38 | 1456642 | 1456884 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 39 | 1170456 | 1170737 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 40 | 225090 | 225386 | + | NZ_AP019367.1 | Parolsenella catena |
| 41 | 1940357 | 1940647 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 42 | 1838676 | 1838921 | - | NC_014363.1 | Olsenella uli DSM 7084 |
| 43 | 2021052 | 2021324 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 44 | 825532 | 825819 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 45 | 1193193 | 1193480 | - | NZ_LT821227.1 | Phoenicibacter congonensis |
| 46 | 474497 | 474778 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 47 | 1543236 | 1543523 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 48 | 5056 | 5301 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 49 | 1515070 | 1515324 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 50 | 195318 | 195560 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 51 | 944135 | 944380 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 52 | 1825868 | 1826110 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 53 | 192357 | 192599 | + | NZ_CP043998.1 | Clostridium diolis |
| 54 | 1297373 | 1297672 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 55 | 2071902 | 2072189 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 56 | 2748876 | 2749118 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 57 | 646232 | 646516 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 58 | 35587 | 35877 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 59 | 470738 | 471031 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 60 | 506459 | 506752 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 61 | 852175 | 852459 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 62 | 2612294 | 2612578 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 63 | 2155415 | 2155702 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 64 | 220426 | 220668 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 65 | 449643 | 449942 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 66 | 502306 | 502605 | + | NZ_CP030280.1 | Blautia argi |
| 67 | 1143204 | 1143488 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 68 | 2718580 | 2718864 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 69 | 1674039 | 1674323 | - | NZ_LT906470.1 | Veillonella rodentium |
| 70 | 1616290 | 1616574 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 71 | 1672886 | 1673170 | - | NZ_LR134375.1 | Veillonella dispar |
| 72 | 1732556 | 1732840 | - | NZ_LR778174.1 | Veillonella parvula |
| 73 | 1405097 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 74 | 48694 | 48975 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 75 | 757741 | 758037 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 76 | 1134189 | 1134476 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 77 | 681883 | 682164 | + | NZ_CP009302.1 | Berryella intestinalis |
| 78 | 4074394 | 4074681 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 79 | 2124065 | 2124352 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 80 | 5616534 | 5616776 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 81 | 201645 | 201932 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 82 | 974992 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 83 | 314539 | 314790 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 84 | 896648 | 896923 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 85 | 2201211 | 2201486 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 86 | 1669466 | 1669744 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 87 | 503574 | 503858 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 88 | 1038899 | 1039141 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 89 | 1146263 | 1146505 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 90 | 1819299 | 1819541 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 91 | 1216012 | 1216254 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 92 | 1813024 | 1813266 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 93 | 1003683 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 94 | 2403800 | 2404042 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 95 | 491341 | 491625 | - | NZ_CP009228.1 | Treponema putidum |
| 96 | 807774 | 808058 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 97 | 1443002 | 1443289 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 98 | 1134479 | 1134775 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 99 | 333731 | 333973 | + | NZ_LN879430.1 | Herbinix luporum |
| 100 | 1554249 | 1554491 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 101 | 1441311 | 1441598 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 102 | 1728916 | 1729191 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 103 | 2377577 | 2377864 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 104 | 6979847 | 6980104 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 105 | 1483248 | 1483517 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 106 | 919840 | 920085 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 107 | 107095 | 107397 | + | NZ_LT635455.1 | Olsenella timonensis |
| 108 | 365450 | 365692 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 109 | 4477392 | 4477661 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 110 | 1288093 | 1288377 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 111 | 3953468 | 3953758 | - | NZ_CP019870.1 | Clostridioides difficile |
| 112 | 490453 | 490752 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 113 | 844332 | 844631 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 114 | 1761659 | 1761940 | - | NZ_LR134484.1 | Gemella haemolysans |
| 115 | 2323394 | 2323684 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 116 | 254267 | 254560 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 117 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 118 | 2174185 | 2174427 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 119 | 475735 | 476013 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 120 | 558708 | 558986 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 121 | 3247085 | 3247327 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 122 | 1176108 | 1176353 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 123 | 1784087 | 1784362 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 124 | 1867299 | 1867595 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 125 | 2582964 | 2583263 | + | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 126 | 1279694 | 1279969 | + | NZ_CP027770.1 | Staphylococcus felis |
| 127 | 2273561 | 2273830 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 128 | 208937 | 209212 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 129 | 1151892 | 1152134 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 130 | 3257118 | 3257417 | + | NZ_CP049863.1 | Leucobacter viscericola |
| 131 | 2062357 | 2062650 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 132 | 73709 | 74008 | + | NC_012924.1 | Streptococcus suis SC84 |
| 133 | 288223 | 288513 | - | NZ_CP026363.1 | Brevibacillus agri |
| 134 | 75014 | 75313 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 135 | 627761 | 628063 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 136 | 2316216 | 2316491 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 137 | 92698 | 92994 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 138 | 56566 | 56862 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 139 | 274358 | 274627 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 140 | 407465 | 407752 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 141 | 4354252 | 4354521 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 142 | 782679 | 782921 | + | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
| 143 | 1172413 | 1172709 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 144 | 1942417 | 1942710 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 145 | 2013261 | 2013554 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 146 | 756121 | 756396 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 147 | 754468 | 754710 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 148 | 394504 | 394779 | + | NZ_CP049257.1 | Nocardioides anomalus |
| 149 | 193441 | 193722 | - | NZ_CP046314.1 | Gemella morbillorum |
| 150 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 151 | 1769971 | 1770246 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 152 | 705695 | 705970 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 153 | 126368 | 126652 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 154 | 1983704 | 1983979 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 155 | 239383 | 239658 | + | NZ_CP047361.1 | Macrococcus canis |
| 156 | 789811 | 790086 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 157 | 514688 | 514975 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 158 | 1674261 | 1674548 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 159 | 566320 | 566607 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 160 | 427007 | 427294 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 161 | 709406 | 709681 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 162 | 761492 | 761767 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 163 | 2244015 | 2244302 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 164 | 1547182 | 1547496 | - | NZ_CP070228.1 | Arcanobacterium phocisimile |
| 165 | 1059084 | 1059359 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 166 | 1966124 | 1966411 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 167 | 3436645 | 3436896 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 168 | 439341 | 439595 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 169 | 2688082 | 2688357 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 170 | 470981 | 471235 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 171 | 769750 | 770025 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 172 | 723120 | 723395 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 173 | 3537051 | 3537332 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 174 | 2115019 | 2115306 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 175 | 129110 | 129400 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 176 | 2167442 | 2167738 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 177 | 1349937 | 1350182 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 178 | 324025 | 324300 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 179 | 881956 | 882231 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 180 | 1151868 | 1152164 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 181 | 129617 | 129901 | + | NZ_LS483476.1 | Lederbergia lentus |
| 182 | 695586 | 695900 | + | NZ_LS483427.1 | Arcanobacterium haemolyticum |
| 183 | 1421030 | 1421332 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 184 | 1194976 | 1195263 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 185 | 356056 | 356334 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 186 | 1979260 | 1979535 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 187 | 2341130 | 2341414 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 188 | 2967914 | 2968168 | + | NZ_CP026100.1 | Caulobacter flavus |
| 189 | 110274 | 110561 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 190 | 1408343 | 1408630 | - | NZ_CP043404.1 | Bacillus safensis |
| 191 | 1491277 | 1491564 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 192 | 1708015 | 1708269 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 193 | 1457211 | 1457465 | - | NZ_CP054836.1 | Oricola thermophila |
| 194 | 1298759 | 1299028 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 195 | 938274 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 196 | 322973 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 197 | 1823415 | 1823690 | - | NZ_CP060782.1 | Sphingomonas sediminicola |
| 198 | 2325958 | 2326203 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 199 | 145411 | 145698 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 200 | 234243 | 234509 | - | NZ_CP024920.1 | Qipengyuania seohaensis |
| 201 | 3996838 | 3997080 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 202 | 5465402 | 5465644 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 203 | 1927790 | 1928059 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 204 | 2732567 | 2732845 | + | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 205 | 131673 | 131960 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 206 | 142995 | 143282 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 207 | 1316305 | 1316577 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 208 | 230706 | 230975 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 209 | 3450598 | 3450888 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 210 | 1379389 | 1379658 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 211 | 529771 | 530040 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 212 | 1329021 | 1329305 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 213 | 1321166 | 1321435 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012785.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.95 | 202 | 2270.5 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 0.95 | 203 | 1576 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 0.95 | 203 | 1576 | same-strand | KH domain |
| 4 | PF00237.21 | 0.96 | 204 | 1208.5 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 0.97 | 207 | 908 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 0.97 | 207 | 30 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 0.97 | 207 | 30 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 213 | 0 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 0.99 | 210 | 1345.0 | same-strand | Ribosomal protein S10p/S20e |
| 10 | PF00009.29 | 0.61 | 130 | 2299 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03144.27 | 0.62 | 131 | 2299 | same-strand | Elongation factor Tu domain 2 |
++ More..