Result : C5CGF0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative regulatory protein Kole_1849 |
| NCBI Accession ID | CP001634.1 |
| Organism | Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1) |
| Left | 1980478 |
| Right | 1980777 |
| Strand | - |
| Nucleotide Sequence | GTGTACGGACTTATCAATGTTGGGTTTGGAAACGTAATCATTGGGGATCGTGTTATAGCGATTGTTAACCCTGAATCAGCTCCCTTGAAAAGACTAAAAGAGGTTGCCAAAGAGGAAGGAAAGCTAATAGACGCTACTTACGGTAGAAAAACTCGTGCTATTGTAATCACTGACAGTAACCACGTTATTCTCAGCGCAATTCAACCAGAAACAATCGCTTCTCGTTTCATGCAAACCTTCACGGACATCGAGAAACTTCTCGAAGAAATCAGACAGGCGGAGAGACGGACGGAAGAATGA |
| Sequence | MYGLINVGFGNVIIGDRVIAIVNPESAPLKRLKEVAKEEGKLIDATYGRKTRAIVITDSNHVILSAIQPETIASRFMQTFTDIEKLLEEIRQAERRTEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00898. Profile Description: Domain of unknown function (DUF370). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412637 |
| Functional Category | Others |
| Uniprot ID | C5CGF0 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1980478 | 1980777 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 2 | 313357 | 313656 | - | NZ_LS974202.1 | Mesotoga infera |
| 3 | 775457 | 775756 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 4 | 1910888 | 1911187 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 5 | 1626685 | 1626978 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 6 | 103577 | 103861 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 7 | 337148 | 337432 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 8 | 1826692 | 1826973 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 9 | 56075 | 56350 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 10 | 2057634 | 2057915 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 11 | 1279143 | 1279418 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 12 | 1548818 | 1549093 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 13 | 1514878 | 1515153 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 14 | 1697175 | 1697450 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 15 | 1732230 | 1732505 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 16 | 1152865 | 1153143 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 17 | 1016572 | 1016850 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 18 | 1146053 | 1146331 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 19 | 873897 | 874175 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 20 | 484972 | 485289 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 21 | 241628 | 241921 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 22 | 97467 | 97754 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 23 | 99131 | 99418 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 24 | 1171445 | 1171726 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 25 | 916204 | 916461 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 26 | 1431084 | 1431356 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 27 | 3509389 | 3509667 | + | NZ_CP061799.1 | Desulfonema limicola |
| 28 | 1387328 | 1387570 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 29 | 2977605 | 2977859 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 30 | 3207805 | 3208083 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 31 | 1179586 | 1179891 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 32 | 2236592 | 2236897 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 33 | 106442 | 106699 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 34 | 1002854 | 1003105 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 35 | 992098 | 992361 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 36 | 2201038 | 2201322 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 37 | 4188295 | 4188558 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 38 | 2249270 | 2249542 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 39 | 2488053 | 2488328 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 40 | 2151249 | 2151503 | - | NZ_CP036259.1 | Sporomusa termitida |
| 41 | 1868597 | 1868875 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 42 | 109344 | 109610 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 43 | 1294516 | 1294764 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 44 | 6447290 | 6447550 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 45 | 2116318 | 2116581 | + | NZ_CP053989.1 | Niallia circulans |
| 46 | 1211050 | 1211319 | - | NZ_LR778174.1 | Veillonella parvula |
| 47 | 330829 | 331104 | + | NZ_LT996885.1 | Dialister massiliensis |
| 48 | 2300214 | 2300480 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 49 | 1402656 | 1402925 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 50 | 1570980 | 1571258 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 51 | 2762956 | 2763219 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 52 | 2107469 | 2107741 | - | NZ_CP030280.1 | Blautia argi |
| 53 | 1788902 | 1789156 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 54 | 4022180 | 4022440 | - | NZ_CP024035.1 | Priestia aryabhattai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04127.17 | 0.67 | 36 | 861.0 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 2 | PF02441.21 | 0.67 | 36 | 861.0 | same-strand | Flavoprotein |
| 3 | PF01192.24 | 0.89 | 48 | 624.5 | same-strand | RNA polymerase Rpb6 |
| 4 | PF00625.23 | 1.0 | 54 | 5.0 | same-strand | Guanylate kinase |
| 5 | PF08340.13 | 0.94 | 51 | 25 | same-strand | Domain of unknown function (DUF1732) |
| 6 | PF03755.15 | 0.94 | 51 | 25 | same-strand | YicC-like family, N-terminal region |
| 7 | PF13238.8 | 0.65 | 35 | 5 | same-strand | AAA domain |
++ More..