Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP001634.1 |
Organism | Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1) |
Left | 1979626 |
Right | 1979865 |
Strand | - |
Nucleotide Sequence | ATGTCTGTGATAATTAATTACGACAAACTTCTCAAAAGGATAAGGCATAAGTACGCTATCCCTATAGCCGCTGCGCGTAGAGCCGAGGGTCTAAAAGACTTTGGTAGGCCAAAACTCGACCCCCAAATGGTGAAACAAGCCGGCGACAAGATAAACATTGCCCTTAAAGAATTGGAAGAGGGTCGCATAGTCATCAGAAACGAAGAAATGTTGAAAATCCTCGTCCCAAAGGTAAAATGA |
Sequence | MSVIINYDKLLKRIRHKYAIPIAAARRAEGLKDFGRPKLDPQMVKQAGDKINIALKELEEGRIVIRNEEMLKILVPKVK |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | |
Domain | |
Functional Category | Others |
Uniprot ID | C5CGE8 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1979626 | 1979865 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
2 | 776366 | 776599 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
3 | 312513 | 312746 | - | NZ_LS974202.1 | Mesotoga infera |
4 | 1911801 | 1912034 | + | NZ_CP011232.1 | Kosmotoga pacifica |
5 | 336303 | 336530 | - | NC_011653.1 | Thermosipho africanus TCF52B |
6 | 102732 | 102959 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
7 | 1278289 | 1278519 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
8 | 1696321 | 1696539 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
9 | 1731376 | 1731594 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
10 | 2098833 | 2099033 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00625.23 | 0.9 | 9 | -3 | same-strand | Guanylate kinase |
2 | PF04025.14 | 1.0 | 10 | 618.0 | same-strand | Domain of unknown function (DUF370) |
3 | PF08340.13 | 1.0 | 10 | 925.5 | same-strand | Domain of unknown function (DUF1732) |
4 | PF03755.15 | 1.0 | 10 | 925.5 | same-strand | YicC-like family, N-terminal region |