Result : C5CGE8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001634.1 |
| Organism | Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1) |
| Left | 1979626 |
| Right | 1979865 |
| Strand | - |
| Nucleotide Sequence | ATGTCTGTGATAATTAATTACGACAAACTTCTCAAAAGGATAAGGCATAAGTACGCTATCCCTATAGCCGCTGCGCGTAGAGCCGAGGGTCTAAAAGACTTTGGTAGGCCAAAACTCGACCCCCAAATGGTGAAACAAGCCGGCGACAAGATAAACATTGCCCTTAAAGAATTGGAAGAGGGTCGCATAGTCATCAGAAACGAAGAAATGTTGAAAATCCTCGTCCCAAAGGTAAAATGA |
| Sequence | MSVIINYDKLLKRIRHKYAIPIAAARRAEGLKDFGRPKLDPQMVKQAGDKINIALKELEEGRIVIRNEEMLKILVPKVK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C5CGE8 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1979626 | 1979865 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 2 | 776366 | 776599 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 3 | 312513 | 312746 | - | NZ_LS974202.1 | Mesotoga infera |
| 4 | 1911801 | 1912034 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 5 | 336303 | 336530 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 6 | 102732 | 102959 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 7 | 1278289 | 1278519 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 8 | 1696321 | 1696539 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 9 | 1731376 | 1731594 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 10 | 2098833 | 2099033 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012785.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.9 | 9 | -3 | same-strand | Guanylate kinase |
| 2 | PF04025.14 | 1.0 | 10 | 618.0 | same-strand | Domain of unknown function (DUF370) |
| 3 | PF08340.13 | 1.0 | 10 | 925.5 | same-strand | Domain of unknown function (DUF1732) |
| 4 | PF03755.15 | 1.0 | 10 | 925.5 | same-strand | YicC-like family, N-terminal region |
++ More..