Result : C5CA73
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP001628.1 |
| Organism | Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) (Micrococcus lysodeikticus) |
| Left | 878808 |
| Right | 879023 |
| Strand | + |
| Nucleotide Sequence | ATGGAACTGCACGGTTCGCTCAACATGATCGGCTACGGCCTCGCCGCCATCGGCTCCGCCATCGGCGTGGGCCTGATCTTCGCCGCCTACATCAACGGCGTCGCCCGTCAGCCGGAGGCCCAGCGCATCCTGCAGCCGATCGCCCTCCTGGGCTTCGCGCTCGCCGAGGCACTCGCCATCCTGGGCCTCGTCTTCGCCTTCGTCATCGGCGCCTGA |
| Sequence | MELHGSLNMIGYGLAAIGSAIGVGLIFAAYINGVARQPEAQRILQPIALLGFALAEALAILGLVFAFVIGA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 19948807 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | C5CA73 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 216
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 878808 | 879023 | + | NC_012803.1 | Micrococcus luteus NCTC 2665 |
| 2 | 2444339 | 2444554 | - | NZ_CP013745.1 | Arthrobacter alpinus |
| 3 | 1183557 | 1183748 | + | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 4 | 1413751 | 1413960 | + | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 5 | 1343493 | 1343702 | + | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 6 | 124098 | 124286 | + | NZ_CP042260.1 | Glutamicibacter halophytocola |
| 7 | 3558087 | 3558305 | - | NZ_CP029642.1 | Arthrobacter dokdonellae |
| 8 | 4697242 | 4697445 | - | NZ_CP018863.1 | Arthrobacter crystallopoietes |
| 9 | 1486840 | 1487049 | - | NZ_CP044548.2 | Janibacter melonis |
| 10 | 881586 | 881795 | + | NZ_CP013290.1 | Janibacter indicus |
| 11 | 278578 | 278793 | + | NZ_CP018135.1 | Neomicrococcus aestuarii |
| 12 | 3264129 | 3264314 | + | NZ_CP060713.1 | Nocardioides mesophilus |
| 13 | 2065194 | 2065409 | - | NZ_LR131272.1 | Arthrobacter agilis |
| 14 | 2582091 | 2582294 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 15 | 4147995 | 4148198 | - | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 16 | 2155417 | 2155626 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 17 | 1536806 | 1536994 | - | NZ_CP011005.1 | Psychromicrobium lacuslunae |
| 18 | 771314 | 771529 | + | NZ_CP038213.1 | Ornithinimicrobium flavum |
| 19 | 2728319 | 2728519 | - | NC_014830.1 | Intrasporangium calvum DSM 43043 |
| 20 | 659645 | 659827 | + | NZ_CP040887.1 | Serinicoccus chungangensis |
| 21 | 2812775 | 2812978 | - | NZ_CP068013.1 | Paenarthrobacter ureafaciens |
| 22 | 1235203 | 1235406 | + | NC_010168.1 | Renibacterium salmoninarum ATCC 33209 |
| 23 | 1078540 | 1078746 | + | NZ_LT906453.1 | Dermatophilus congolensis |
| 24 | 2547538 | 2547726 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 25 | 2024476 | 2024676 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 26 | 2009761 | 2009952 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 27 | 1121894 | 1122106 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 28 | 991577 | 991786 | + | NZ_CP061538.1 | Rothia amarae |
| 29 | 438863 | 439048 | - | NZ_CP041146.1 | Nocardioides humi |
| 30 | 1387127 | 1387339 | - | NZ_CP014989.1 | Serinicoccus hydrothermalis |
| 31 | 2261376 | 2261600 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 32 | 2923551 | 2923739 | + | NZ_CP038436.1 | Nocardioides seonyuensis |
| 33 | 6403672 | 6403899 | - | NZ_AP022870.1 | Phytohabitans flavus |
| 34 | 1693621 | 1693848 | - | NZ_CP043661.1 | Kribbella qitaiheensis |
| 35 | 5449366 | 5449593 | - | NC_013729.1 | Kribbella flavida DSM 17836 |
| 36 | 924051 | 924260 | + | NZ_CP056080.1 | Rothia nasimurium |
| 37 | 1352703 | 1352915 | + | NZ_LR134442.1 | Propionibacterium australiense |
| 38 | 62703 | 62915 | - | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 39 | 3245605 | 3245832 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 40 | 655282 | 655488 | + | NZ_CP044427.1 | Ornithinimicrobium pratense |
| 41 | 1008979 | 1009188 | + | NZ_CP061539.1 | Rothia terrae |
| 42 | 1106109 | 1106318 | - | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 43 | 4441329 | 4441562 | - | NZ_CP045309.1 | Micromonospora terminaliae |
| 44 | 5231399 | 5231608 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 45 | 7315375 | 7315611 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 46 | 1418468 | 1418680 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 47 | 6215516 | 6215749 | - | NZ_CP058322.1 | Micromonospora carbonacea |
| 48 | 4561276 | 4561500 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 49 | 1351086 | 1351298 | - | NC_006085.1 | Cutibacterium acnes KPA171202 |
| 50 | 1369526 | 1369735 | - | NZ_LT593929.1 | Propionibacterium freudenreichii |
| 51 | 4163826 | 4164050 | - | NC_009380.1 | Salinispora tropica CNB-440 |
| 52 | 5774816 | 5775049 | - | NC_014391.1 | Micromonospora aurantiaca ATCC 27029 |
| 53 | 8157581 | 8157808 | - | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 54 | 7805178 | 7805408 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 55 | 1680637 | 1680825 | + | NZ_CP025198.1 | Acidipropionibacterium virtanenii |
| 56 | 570740 | 570928 | - | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 57 | 1043668 | 1043880 | + | NC_021064.1 | Cutibacterium avidum 44067 |
| 58 | 4354241 | 4354468 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 59 | 1633266 | 1633478 | - | NZ_LT906441.1 | Cutibacterium granulosum |
| 60 | 2339454 | 2339684 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 61 | 3947353 | 3947577 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 62 | 2438293 | 2438505 | + | NZ_CP040635.1 | Acidipropionibacterium jensenii |
| 63 | 976679 | 976903 | - | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 64 | 2867547 | 2867780 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 65 | 2303337 | 2303594 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 66 | 1224968 | 1225222 | + | NZ_CP008953.1 | Amycolatopsis japonica |
| 67 | 4486816 | 4487058 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 68 | 7036472 | 7036699 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 69 | 1995692 | 1995946 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
| 70 | 1597208 | 1597462 | + | NZ_CP016174.1 | Amycolatopsis orientalis |
| 71 | 3372685 | 3372921 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 72 | 7356882 | 7357139 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 73 | 1911588 | 1911779 | + | NC_014643.1 | Rothia dentocariosa ATCC 17931 |
| 74 | 3415069 | 3415296 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 75 | 5420067 | 5420297 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 76 | 2283167 | 2283358 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 77 | 4440749 | 4440928 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 78 | 976458 | 976643 | + | NZ_CP060789.1 | Tessaracoccus defluvii |
| 79 | 5551325 | 5551552 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 80 | 10383463 | 10383657 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 81 | 284394 | 284579 | - | NZ_LR214441.1 | Tessaracoccus lapidicaptus |
| 82 | 2844048 | 2844251 | - | NZ_CP013254.1 | Kocuria flava |
| 83 | 972217 | 972426 | + | NZ_LR134479.1 | Rothia aeria |
| 84 | 2771889 | 2772125 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 85 | 2497404 | 2497652 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 86 | 4861832 | 4862080 | - | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 87 | 8590906 | 8591127 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 88 | 4636543 | 4636779 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 89 | 954150 | 954356 | + | NZ_CP012507.1 | Kocuria palustris |
| 90 | 2774838 | 2775068 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 91 | 6428243 | 6428494 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 92 | 5072165 | 5072416 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 93 | 2969195 | 2969425 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 94 | 1781168 | 1781395 | - | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 95 | 6195565 | 6195816 | + | NZ_CP027306.1 | Streptomyces atratus |
| 96 | 6100185 | 6100433 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 97 | 2207444 | 2207671 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 98 | 1908187 | 1908414 | - | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 99 | 2221834 | 2222061 | - | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
| 100 | 8207020 | 8207253 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 101 | 5135461 | 5135691 | + | NZ_CP029043.1 | Streptomyces nigra |
| 102 | 3319287 | 3319517 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 103 | 1880505 | 1880732 | - | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 104 | 2503414 | 2503650 | - | NZ_CP018762.1 | Microbacterium aurum |
| 105 | 6448358 | 6448594 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 106 | 5312824 | 5313054 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 107 | 2565245 | 2565475 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 108 | 2451409 | 2451642 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 109 | 4275017 | 4275250 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 110 | 3277269 | 3277499 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 111 | 6333315 | 6333551 | + | NZ_CP022685.1 | Streptomyces formicae |
| 112 | 1020557 | 1020781 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 113 | 1147213 | 1147470 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
| 114 | 1182080 | 1182331 | + | NZ_CP030862.1 | Streptomyces globosus |
| 115 | 1390286 | 1390522 | + | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 116 | 3270708 | 3270941 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 117 | 4803665 | 4803907 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 118 | 4979327 | 4979551 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 119 | 5421422 | 5421646 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 120 | 5865679 | 5865927 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 121 | 1597845 | 1598093 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 122 | 1399032 | 1399220 | - | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 123 | 4502067 | 4502303 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 124 | 1525150 | 1525338 | + | NZ_LR134406.1 | Arachnia propionica |
| 125 | 2293520 | 2293747 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 126 | 4736544 | 4736780 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 127 | 3261786 | 3262022 | - | NZ_CP035491.1 | Agromyces protaetiae |
| 128 | 2327520 | 2327765 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 129 | 1470342 | 1470587 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 130 | 3045341 | 3045568 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 131 | 5137045 | 5137281 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 132 | 1007282 | 1007491 | + | NZ_CP031423.1 | Microbacterium lemovicicum |
| 133 | 3531439 | 3531681 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 134 | 1088783 | 1088983 | + | NZ_CP035504.1 | Kocuria indica |
| 135 | 492123 | 492359 | - | NZ_CP049255.1 | Microbacterium endophyticum |
| 136 | 2887295 | 2887522 | + | NZ_CP035806.1 | Leucobacter triazinivorans |
| 137 | 3217010 | 3217240 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 138 | 5448178 | 5448426 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 139 | 7087862 | 7088077 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 140 | 3282782 | 3283006 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 141 | 433707 | 433937 | + | NZ_CP007490.1 | Rhodoluna lacicola |
| 142 | 148706 | 148936 | + | NZ_AP012322.1 | Bifidobacterium angulatum DSM 20098 = JCM 7096 |
| 143 | 2112884 | 2113129 | - | NZ_CP031421.1 | Microbacterium oleivorans |
| 144 | 2533753 | 2533986 | - | NZ_CP022310.1 | Streptomyces calvus |
| 145 | 5352592 | 5352840 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 146 | 2808895 | 2809143 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 147 | 2883766 | 2883984 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 148 | 5335148 | 5335369 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 149 | 3193060 | 3193281 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 150 | 3066309 | 3066530 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 151 | 6895911 | 6896135 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 152 | 7306690 | 7306923 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 153 | 1862504 | 1862722 | + | NZ_CP025333.1 | Brevibacterium aurantiacum |
| 154 | 2189381 | 2189611 | - | NZ_CP020715.1 | Cnuibacter physcomitrellae |
| 155 | 1723150 | 1723380 | - | NZ_CP022544.1 | Bifidobacterium pseudolongum |
| 156 | 2331665 | 2331886 | + | NZ_LT996886.1 | Tessaracoccus timonensis |
| 157 | 355240 | 355470 | - | NZ_CP018044.1 | Bifidobacterium choerinum |
| 158 | 2991083 | 2991322 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 159 | 6535528 | 6535734 | + | NZ_CP070326.1 | Streptomyces noursei |
| 160 | 183975 | 184160 | - | NZ_CP061344.1 | Microbacterium hominis |
| 161 | 212410 | 212622 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 162 | 7331422 | 7331664 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 163 | 522459 | 522686 | - | NC_004572.3 | Tropheryma whipplei str. Twist |
| 164 | 5977242 | 5977484 | + | NZ_CP023691.1 | Streptomyces platensis |
| 165 | 1369383 | 1369577 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 166 | 2543994 | 2544212 | + | NZ_CP065682.1 | Brevibacterium casei |
| 167 | 1695544 | 1695750 | + | NZ_CP026734.1 | Brevibacterium linens |
| 168 | 6610203 | 6610403 | - | NZ_AP023396.1 | Nocardia wallacei |
| 169 | 3339606 | 3339851 | - | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 170 | 3889113 | 3889331 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 171 | 108283 | 108501 | + | NZ_CP040336.1 | Bacillus luti |
| 172 | 5043350 | 5043568 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 173 | 5064199 | 5064417 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 174 | 5229627 | 5229845 | - | NC_011725.1 | Bacillus cereus B4264 |
| 175 | 5267343 | 5267561 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 176 | 708338 | 708550 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 177 | 956564 | 956776 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 178 | 870320 | 870532 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 179 | 1012431 | 1012643 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 180 | 2074180 | 2074392 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 181 | 51585 | 51797 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 182 | 6437406 | 6437591 | - | NC_008278.1 | Frankia alni ACN14a |
| 183 | 4893383 | 4893595 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 184 | 1716438 | 1716632 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 185 | 839239 | 839445 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 186 | 896533 | 896739 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 187 | 1873328 | 1873534 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 188 | 105949 | 106161 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 189 | 819890 | 820102 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 190 | 1325348 | 1325560 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 191 | 860725 | 860937 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 192 | 609125 | 609337 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 193 | 897916 | 898128 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 194 | 2041914 | 2042126 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 195 | 2128112 | 2128324 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 196 | 2172982 | 2173194 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 197 | 1978826 | 1979044 | + | NZ_CP008802.1 | Actinotignum schaalii |
| 198 | 6342131 | 6342379 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 199 | 3507606 | 3507854 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 200 | 4467179 | 4467400 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 201 | 1776351 | 1776581 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 202 | 5610204 | 5610440 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 203 | 4445630 | 4445836 | - | NC_007777.1 | Frankia casuarinae |
| 204 | 5946801 | 5947037 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 205 | 6137778 | 6138014 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 206 | 5781282 | 5781488 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 207 | 5215841 | 5216077 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 208 | 1937857 | 1938099 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 209 | 1781083 | 1781316 | + | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 210 | 1168498 | 1168683 | + | NC_014666.1 | Frankia inefficax |
| 211 | 6346036 | 6346275 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 212 | 5537028 | 5537258 | + | NZ_CP031194.1 | Streptomyces paludis |
| 213 | 5794494 | 5794733 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 214 | 5711030 | 5711260 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 215 | 5151613 | 5151852 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 216 | 5565837 | 5566043 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 217 | 1885583 | 1885777 | - | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012803.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00953.23 | 0.76 | 165 | 1837 | same-strand | Glycosyl transferase family 4 |
| 2 | PF00119.22 | 0.99 | 213 | 77 | same-strand | ATP synthase A chain |
| 3 | PF00430.20 | 1.0 | 215 | 42 | same-strand | ATP synthase B/B' CF(0) |
| 4 | PF00213.20 | 0.99 | 214 | 594.0 | same-strand | ATP synthase delta (OSCP) subunit |
| 5 | PF00006.27 | 0.99 | 214 | 1700 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 6 | PF00306.29 | 1.0 | 215 | 1510 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 7 | PF02874.25 | 1.0 | 215 | 1664 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 8 | PF00231.21 | 0.99 | 214 | 3137.0 | same-strand | ATP synthase |
++ More..