ProsmORF-pred
Result : C5C3G5
Protein Information
Information Type Description
Protein name 50S ribosomal protein L32
NCBI Accession ID CP001618.1
Organism Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432)
Left 1850829
Right 1851029
Strand +
Nucleotide Sequence GTGGCTGTTCCCAAGCGCAAGATGTCGCGCAGCAACACCCGGGCGCGCCGCTCGCAGTGGAAGGCGACTGCGGCGACGCTCACGACGTGCGAGAACTGCAAGGCTCCGCGTCAGTCGCACCAGGCGTGCCCGCAGTGCGGTCAGTACGCCGGTCGCACGTACGCCGAGGCGATCCGGACGGACGCCGTCGAGACGCGCTGA
Sequence MAVPKRKMSRSNTRARRSQWKATAATLTTCENCKAPRQSHQACPQCGQYAGRTYAEAIRTDAVETR
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Pubmed ID 21304633
Domain CDD:415589
Functional Category Ribosomal_protein
Uniprot ID C5C3G5
ORF Length (Amino Acid) 66
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 180
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1850829 1851029 + NC_012669.1 Beutenbergia cavernae DSM 12333
2 252283 252477 + NZ_CP035495.1 Xylanimonas allomyrinae
3 2250311 2250505 - NC_015588.1 Isoptericola variabilis 225
4 2459778 2459972 - NC_013530.1 Xylanimonas cellulosilytica DSM 15894
5 3240961 3241155 - NZ_CP041694.1 Cellulosimicrobium cellulans
6 1306224 1306418 + NC_013521.1 Sanguibacter keddieii DSM 10542
7 2705706 2705903 - NC_015514.1 Cellulomonas fimi ATCC 484
8 153961 154155 + NZ_CP014209.1 Isoptericola dokdonensis DS-3
9 1801238 1801432 - NZ_LS483423.1 Jonesia denitrificans
10 1285529 1285726 + NC_015671.1 Cellulomonas gilvus ATCC 13127
11 2623893 2624084 - NZ_CP045529.1 Luteimicrobium xylanilyticum
12 1052520 1052714 + NZ_CP051884.1 Cellulomonas taurus
13 1012531 1012725 + NZ_CP013290.1 Janibacter indicus
14 2473042 2473236 - NZ_CP038213.1 Ornithinimicrobium flavum
15 2183478 2183672 - NZ_CP044427.1 Ornithinimicrobium pratense
16 1374517 1374711 - NZ_CP044548.2 Janibacter melonis
17 3542988 3543182 + NZ_CP014989.1 Serinicoccus hydrothermalis
18 2584366 2584560 - NC_014830.1 Intrasporangium calvum DSM 43043
19 2116904 2117098 - NZ_CP040887.1 Serinicoccus chungangensis
20 1352306 1352503 + NZ_CP039291.1 Cellulomonas shaoxiangyii
21 1203620 1203814 + NZ_LT906453.1 Dermatophilus congolensis
22 310120 310314 - NZ_CP022544.1 Bifidobacterium pseudolongum
23 4356826 4357008 + NZ_CP016793.1 Lentzea guizhouensis
24 5718453 5718626 + NZ_CP023695.1 Streptomyces alboniger
25 4729673 4729846 + NZ_CP029254.1 Streptomyces spongiicola
26 2693050 2693223 - NZ_CP011340.1 Streptomyces pristinaespiralis
27 6652350 6652523 + NZ_CP022685.1 Streptomyces formicae
28 981405 981599 - NZ_CP018044.1 Bifidobacterium choerinum
29 1404373 1404546 + NZ_CP030862.1 Streptomyces globosus
30 3053865 3054038 - NZ_CP023699.1 Streptomyces kanamyceticus
31 8325979 8326161 - NZ_CP007155.1 Kutzneria albida DSM 43870
32 1875849 1876022 - NZ_CP048882.1 Streptomyces bathyalis
33 4984228 4984401 + NZ_CP029188.1 Streptomyces tirandamycinicus
34 5657172 5657345 + NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
35 5685738 5685911 + NZ_CP042266.1 Streptomyces qinzhouensis
36 2414179 2414373 + NZ_CP011112.1 Luteipulveratus mongoliensis
37 265083 265277 - NZ_AP012322.1 Bifidobacterium angulatum DSM 20098 = JCM 7096
38 5380131 5380304 + NZ_CP029043.1 Streptomyces nigra
39 5446435 5446608 + NZ_AP023439.1 Streptomyces tuirus
40 2264164 2264337 - NZ_CP022310.1 Streptomyces calvus
41 6618535 6618708 + NZ_CP047020.1 Streptomyces broussonetiae
42 2802528 2802701 - NZ_CP051006.1 Streptomyces griseofuscus
43 5396817 5396990 + NZ_CP072827.1 Streptomyces mobaraensis NBRC 13819 = DSM 40847
44 2766944 2767117 - NZ_CP023688.1 Streptomyces rimosus
45 7931256 7931429 - NZ_CP063373.1 Streptomyces ferrugineus
46 6633891 6634064 + NZ_CP023694.1 Streptomyces coeruleorubidus
47 6366690 6366863 + NZ_CP020569.1 Streptomyces gilvosporeus
48 6239348 6239521 + NZ_CP023691.1 Streptomyces platensis
49 4068389 4068571 - NZ_CP015163.1 Amycolatopsis albispora
50 6242802 6242975 + NZ_CP023407.1 Streptomyces fungicidicus
51 5199903 5200076 + NZ_CP015866.1 Streptomyces parvulus
52 5376461 5376634 + NZ_CP021080.1 Streptomyces pluripotens
53 1487978 1488151 - NC_020990.1 Streptomyces albidoflavus
54 1867010 1867183 - NZ_CP031742.1 Streptomyces koyangensis
55 6028677 6028850 + NC_021985.1 Streptomyces collinus Tu 365
56 6402623 6402796 + NZ_CP015098.1 Streptomyces qaidamensis
57 4723498 4723671 + NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
58 1943776 1943949 + NZ_CP016279.1 Streptomyces griseochromogenes
59 5854056 5854229 + NZ_CP063374.1 Streptomyces chromofuscus
60 6213207 6213380 + NZ_CP021978.1 Streptomyces hawaiiensis
61 4495378 4495551 + NZ_CP032229.1 Streptomyces seoulensis
62 7380065 7380238 + NZ_CP034463.1 Streptomyces aquilus
63 3258473 3258646 - NZ_CP017248.1 Streptomyces fodineus
64 6049168 6049341 + NZ_CP019457.1 Streptomyces lydicus
65 6844460 6844642 - NC_009142.1 Saccharopolyspora erythraea NRRL 2338
66 7597465 7597638 + NZ_CP065050.1 Streptomyces solisilvae
67 4538435 4538608 - NC_016582.1 Streptomyces bingchenggensis BCW-1
68 7193383 7193556 + NZ_CP034539.1 Streptomyces cyaneochromogenes
69 2963171 2963344 - NZ_CP030073.1 Streptomyces cadmiisoli
70 2529386 2529559 - NZ_CP026652.1 Streptomyces dengpaensis
71 6137141 6137314 + NZ_CP071839.1 Streptomyces cyanogenus
72 6748114 6748287 + NZ_CP023690.1 Streptomyces spectabilis
73 5744941 5745114 + NZ_CP072931.1 Streptomyces auratus AGR0001
74 9247505 9247684 - NZ_CP045572.1 Nonomuraea nitratireducens
75 2317756 2317929 - NZ_CP023701.1 Streptomyces subrutilus
76 2210676 2210849 - NZ_CP023692.1 Streptomyces vinaceus
77 6356179 6356352 + NZ_CP071139.1 Streptomyces nojiriensis
78 264938 265132 - NZ_AP012325.1 Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043
79 311649 311843 - NZ_CP025199.1 Bifidobacterium pseudocatenulatum
80 1760737 1760910 + NZ_CP051486.1 Streptomyces pratensis
81 5690320 5690493 + NZ_CP024957.1 Streptomyces cavourensis
82 6059120 6059293 + NC_021177.1 Streptomyces fulvissimus DSM 40593
83 5863645 5863818 + NZ_CP013738.1 Streptomyces globisporus C-1027
84 2261219 2261392 - NC_010572.1 Streptomyces griseus subsp. griseus NBRC 13350
85 6853185 6853367 - NC_021252.1 Amycolatopsis keratiniphila
86 1819826 1820008 + NZ_CP008953.1 Amycolatopsis japonica
87 6880022 6880204 - NZ_CP016174.1 Amycolatopsis orientalis
88 5994444 5994617 + NZ_CP070242.1 Streptomyces californicus
89 6051532 6051705 + NZ_CP020570.1 Streptomyces violaceoruber
90 433463 433657 - NZ_CP026999.1 Bifidobacterium longum
91 2059567 2059740 - NZ_CP023702.1 Streptomyces nitrosporeus
92 299455 299649 - NZ_CP028341.1 Bifidobacterium adolescentis
93 403170 403364 - NZ_AP012326.1 Bifidobacterium dentium JCM 1195 = DSM 20436
94 453797 453991 - NC_018720.1 Bifidobacterium asteroides PRL2011
95 6488326 6488499 + NZ_CP027306.1 Streptomyces atratus
96 5298070 5298243 + NZ_CP040752.1 Streptomyces rectiverticillatus
97 2566913 2567110 - NC_014151.1 Cellulomonas flavigena DSM 20109
98 3057503 3057676 - NZ_CP023689.1 Streptomyces chartreusis
99 6145213 6145386 + NZ_CP020563.1 Kitasatospora albolonga
100 2724768 2724941 - NZ_CP034687.1 Streptomyces griseoviridis
101 2611591 2611785 + NZ_AP012331.1 Bifidobacterium scardovii JCM 12489 = DSM 13734
102 3269181 3269354 - NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
103 2581215 2581388 - NZ_CP032698.1 Streptomyces hundungensis
104 5592897 5593070 + NZ_CP010849.1 Streptomyces cyaneogriseus subsp. noncyanogenus
105 2564090 2564263 - NZ_LN831790.1 Streptomyces leeuwenhoekii
106 2876513 2876686 - NZ_CP032427.1 Streptomyces griseorubiginosus
107 3006390 3006563 - NC_013929.1 Streptomyces scabiei 87.22
108 7648185 7648358 + NZ_CP045096.1 Streptomyces phaeolivaceus
109 7178444 7178617 - NZ_CP023865.1 Actinoplanes teichomyceticus ATCC 31121
110 3024788 3024961 - NZ_CP045643.1 Streptomyces fagopyri
111 2211206 2211379 - NZ_CP060404.1 Streptomyces buecherae
112 2757440 2757613 - NZ_AP023440.1 Streptomyces glomeroaurantiacus
113 5663143 5663316 + NZ_CP023703.1 Streptomyces galilaeus
114 351940 352134 - NZ_CP006018.1 Bifidobacterium indicum LMG 11587 = DSM 20214
115 365187 365381 - NZ_CP007287.1 Bifidobacterium coryneforme
116 2312941 2313123 + NZ_AP023396.1 Nocardia wallacei
117 2946811 2946984 - NZ_CP022744.1 Streptomyces lincolnensis
118 2233413 2233607 - NZ_CP062938.1 Bifidobacterium eulemuris
119 588049 588243 + NZ_CP062948.1 Bifidobacterium lemurum
120 5835361 5835534 + NZ_CP031194.1 Streptomyces paludis
121 7661405 7661578 - NC_017093.1 Actinoplanes missouriensis 431
122 1817758 1817949 - NZ_LT906441.1 Cutibacterium granulosum
123 431289 431483 - NZ_CP006712.1 Bifidobacterium breve JCM 7017
124 6700187 6700360 + NZ_CP031455.1 Streptomyces olivoreticuli subsp. olivoreticuli
125 3745175 3745357 - NZ_CP045929.1 Saccharopolyspora coralli
126 1460217 1460399 + NZ_CP016353.1 Prauserella marina
127 9549913 9550095 - NZ_CP034550.1 Saccharothrix syringae
128 3444283 3444468 + NZ_CP060713.1 Nocardioides mesophilus
129 6866991 6867173 - NZ_CP023445.1 Actinosynnema pretiosum
130 7010385 7010567 - NC_013093.1 Actinosynnema mirum DSM 43827
131 4964500 4964682 - NZ_CP015235.1 Rhodococcus fascians D188
132 1858983 1859156 + NZ_CP058322.1 Micromonospora carbonacea
133 1795553 1795750 - NZ_CP011786.1 Bifidobacterium actinocoloniiforme DSM 22766
134 2297876 2298058 + NZ_AP017900.1 Nocardia seriolae
135 5229953 5230126 + NZ_AP022871.1 Phytohabitans suffuscus
136 1427848 1428045 + NZ_AP012334.1 Scardovia inopinata JCM 12537
137 9086164 9086337 + NZ_AP022870.1 Phytohabitans flavus
138 319856 320053 - NZ_AP012333.1 Parascardovia denticolens DSM 10105 = JCM 12538
139 4811308 4811490 - NZ_CP041695.1 Nocardia otitidiscaviarum
140 2131949 2132131 - NZ_CP061007.1 Saccharopolyspora spinosa
141 7924476 7924658 + NZ_CP031142.1 Saccharopolyspora pogona
142 1411746 1411919 + NC_014391.1 Micromonospora aurantiaca ATCC 27029
143 4623338 4623517 - NC_014391.1 Micromonospora aurantiaca ATCC 27029
144 1445305 1445478 + NC_009380.1 Salinispora tropica CNB-440
145 3445807 3445986 - NC_009380.1 Salinispora tropica CNB-440
146 1127558 1127731 - NZ_CP061725.1 Micromonospora craniellae
147 1571748 1571927 - NZ_CP061725.1 Micromonospora craniellae
148 192715 192888 + NZ_CP045309.1 Micromonospora terminaliae
149 3204605 3204784 - NZ_CP036250.1 Egicoccus halophilus
150 3547202 3547381 + NZ_CP047156.1 Epidermidibacterium keratini
151 959538 959741 + NC_012803.1 Micrococcus luteus NCTC 2665
152 1575457 1575636 + NZ_CP036353.1 Gimesia maris
153 5652736 5652915 + NZ_AP021861.1 Lacipirellula parvula
154 2292971 2293150 - NZ_CP043930.1 Gimesia benthica
155 366350 366553 + NZ_CP018135.1 Neomicrococcus aestuarii
156 1511273 1511476 + NZ_CP033724.1 Clavibacter michiganensis subsp. michiganensis
157 8810057 8810236 - NC_013595.1 Streptosporangium roseum DSM 43021
158 4378204 4378386 - NZ_CP018863.1 Arthrobacter crystallopoietes
159 1936228 1936410 + NC_022116.1 Amycolatopsis mediterranei RB
160 975209 975391 + NC_013159.1 Saccharomonospora viridis DSM 43017
161 1833835 1834038 - NZ_LR131272.1 Arthrobacter agilis
162 1425851 1426033 + NZ_CP034412.1 Glutamicibacter creatinolyticus
163 2762670 2762873 - NZ_CP013254.1 Kocuria flava
164 6051119 6051301 - NZ_CP016076.1 Actinoalloteichus fjordicus
165 5544773 5544955 - NZ_CP022521.1 Actinoalloteichus hoggarensis
166 2510308 2510490 + NZ_AP023172.1 Rhodococcus qingshengii
167 164290 164493 + NZ_CP035810.1 Brevibacterium luteolum
168 965877 966089 + NZ_LT593929.1 Propionibacterium freudenreichii
169 2355174 2355377 + NZ_CP035491.1 Agromyces protaetiae
170 2577360 2577572 - NZ_LR134442.1 Propionibacterium australiense
171 508178 508390 - NZ_CP033719.1 Propionibacterium acidifaciens
172 8860251 8860433 + NZ_CP022088.2 Nocardia brasiliensis
173 2519797 2519979 - NZ_CP048813.1 Rhodococcus triatomae
174 3509977 3510159 - NZ_CP027793.1 Rhodococcus hoagii
175 4854969 4855151 - NZ_CP018082.1 Nocardia mangyaensis
176 5735468 5735650 - NZ_LR134352.1 Nocardia asteroides
177 2082810 2082992 + NZ_CP029146.1 Rhodococcus ruber
178 4333614 4333796 - NC_006361.1 Nocardia farcinica IFM 10152
179 3228071 3228256 - NC_015564.1 Hoyosella subflava DQS3-9A1
180 2504908 2505081 + NZ_AP023355.1 Actinocatenispora thailandica
181 3645077 3645259 + NZ_CP026746.1 Nocardia cyriacigeorgica
182 9310238 9310411 - NC_013131.1 Catenulispora acidiphila DSM 44928
183 1329765 1329935 + NC_014666.1 Frankia inefficax
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_012669.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF03602.17 0.76 137 2478 same-strand Conserved hypothetical protein 95
2 PF01467.28 0.94 170 1931.5 same-strand Cytidylyltransferase-like
3 PF02620.19 0.98 176 3.0 same-strand Large ribosomal RNA subunit accumulation protein YceD
4 PF14622.8 0.97 174 20.0 same-strand Ribonuclease-III-like
5 PF00636.28 0.97 175 20 same-strand Ribonuclease III domain
6 PF00035.28 0.96 172 20.0 same-strand Double-stranded RNA binding motif
7 PF01149.26 0.88 158 928.5 same-strand Formamidopyrimidine-DNA glycosylase N-terminal domain
8 PF06831.16 0.88 158 928.5 same-strand Formamidopyrimidine-DNA glycosylase H2TH domain
9 PF06827.16 0.78 140 927.0 same-strand Zinc finger found in FPG and IleRS
++ More..