Result : C4ZZI2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PhoP/PhoQ regulator MgrB |
| NCBI Accession ID | CP001396.1 |
| Organism | Escherichia coli (strain K12 / MC4100 / BW2952) |
| Left | 1798706 |
| Right | 1798849 |
| Strand | - |
| Nucleotide Sequence | GTGAAAAAGTTTCGATGGGTCGTTCTGGTTGTCGTGGTGTTGGCTTGCTTGCTGCTTTGGGCGCAGGTATTCAACATGATGTGCGATCAGGATGTACAATTTTTCAGCGGAATTTGTGCCATTAACCAGTTTATCCCGTGGTGA |
| Sequence | MKKFRWVVLVVVVLACLLLWAQVFNMMCDQDVQFFSGICAINQFIPW |
| Source of smORF | Swiss-Prot |
| Function | PhoP-regulated transcription is redox-sensitive, being activated when the periplasm becomes more reducing. MgrB acts between DsbA/DsbB and PhoP/PhoQ in this pathway. Represses PhoP/PhoQ signaling, possibly by binding to the periplasmic domain of PhoQ, altering its activity and that of downstream effector PhoP. {ECO:0000255|HAMAP-Rule:MF_01596}. |
| Pubmed ID | 19376874 |
| Domain | CDD:421261 |
| Functional Category | Others |
| Uniprot ID | C4ZZI2 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2510589 | 2510732 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1908623 | 1908766 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1440754 | 1440897 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1809742 | 1809885 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 237554 | 237697 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 1116578 | 1116721 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 1841535 | 1841678 | - | NZ_AP014857.1 | Escherichia albertii |
| 8 | 1891969 | 1892112 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 9 | 2011796 | 2011939 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 10 | 604292 | 604435 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 11 | 1985016 | 1985162 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 12 | 1546542 | 1546685 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 13 | 2888028 | 2888171 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 14 | 2730250 | 2730393 | - | NC_015968.1 | Enterobacter soli |
| 15 | 2105025 | 2105168 | + | NZ_CP050508.1 | Raoultella terrigena |
| 16 | 690963 | 691106 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 17 | 4491075 | 4491218 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 18 | 2799836 | 2799979 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 19 | 2798787 | 2798930 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 20 | 2776402 | 2776545 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 21 | 2342846 | 2342989 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 22 | 2251908 | 2252051 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 23 | 1948151 | 1948294 | + | NZ_CP054254.1 | Klebsiella variicola |
| 24 | 3337154 | 3337297 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 25 | 1990146 | 1990289 | + | NZ_CP041247.1 | Raoultella electrica |
| 26 | 1880129 | 1880272 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 27 | 2019486 | 2019629 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 28 | 1900142 | 1900285 | + | NZ_CP023525.1 | Cedecea neteri |
| 29 | 2064654 | 2064797 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 30 | 5212688 | 5212831 | - | NZ_CP026047.1 | Raoultella planticola |
| 31 | 3768367 | 3768510 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 32 | 1965040 | 1965183 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 33 | 1462738 | 1462881 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 34 | 1825951 | 1826094 | + | NZ_LR134201.1 | Cedecea lapagei |
| 35 | 2981832 | 2981975 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 36 | 2225488 | 2225631 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 37 | 123298 | 123441 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 38 | 2852545 | 2852688 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 39 | 262122 | 262265 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 40 | 2539890 | 2540033 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 41 | 2678907 | 2679053 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 42 | 1916848 | 1916991 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 43 | 1799380 | 1799526 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 44 | 1941370 | 1941513 | + | NZ_LR134340.1 | Escherichia marmotae |
| 45 | 2788794 | 2788937 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 46 | 4153853 | 4153996 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 47 | 4062285 | 4062431 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 48 | 4259785 | 4259928 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 49 | 1936916 | 1937059 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 50 | 4447932 | 4448075 | - | NZ_CP053416.1 | Salmonella bongori |
| 51 | 562453 | 562596 | - | NZ_CP033744.1 | Citrobacter freundii |
| 52 | 4520958 | 4521101 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 53 | 1821930 | 1822064 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 54 | 1367402 | 1367527 | - | NZ_CP038469.1 | Citrobacter tructae |
| 55 | 2555887 | 2556030 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 56 | 894674 | 894817 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 57 | 2514966 | 2515109 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 58 | 1629577 | 1629720 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 59 | 2597095 | 2597238 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 60 | 1881000 | 1881143 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 61 | 3539266 | 3539409 | + | NZ_CP042941.1 | Atlantibacter hermannii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009792.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02659.17 | 0.73 | 44 | 4093 | opposite-strand | Putative manganese efflux pump |
| 2 | PF13649.8 | 0.97 | 58 | 3360 | same-strand | Methyltransferase domain |
| 3 | PF08241.14 | 0.97 | 58 | 3360 | same-strand | Methyltransferase domain |
| 4 | PF00313.24 | 0.98 | 59 | 1269.5 | same-strand | 'Cold-shock' DNA-binding domain |
| 5 | PF13974.8 | 1.0 | 60 | 75 | same-strand | YebO-like protein |
| 6 | PF13996.8 | 1.0 | 60 | 160 | opposite-strand | YobH-like protein |
| 7 | PF01614.20 | 1.0 | 60 | 463 | same-strand | Bacterial transcriptional regulator |
| 8 | PF09339.12 | 1.0 | 60 | 463 | same-strand | IclR helix-turn-helix domain |
| 9 | PF13412.8 | 1.0 | 60 | 463 | same-strand | Winged helix-turn-helix DNA-binding |
| 10 | PF07690.18 | 0.85 | 51 | 1434.0 | opposite-strand | Major Facilitator Superfamily |
| 11 | PF01435.20 | 1.0 | 60 | 2864 | same-strand | Peptidase family M48 |
| 12 | PF17804.3 | 0.92 | 55 | 3968.5 | same-strand | Tail specific protease N-terminal domain |
| 13 | PF03572.20 | 0.92 | 55 | 3968.5 | same-strand | Peptidase family S41 |
| 14 | PF11818.10 | 0.92 | 55 | 3968.5 | same-strand | C-terminal domain of tail specific protease (DUF3340) |
| 15 | PF00595.26 | 0.92 | 55 | 3968.5 | same-strand | PDZ domain |
| 16 | PF17820.3 | 0.92 | 55 | 3968.5 | same-strand | PDZ domain |
| 17 | PF00905.24 | 0.63 | 38 | 1605.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 18 | PF03717.17 | 0.63 | 38 | 1605.0 | same-strand | Penicillin-binding Protein dimerisation domain |
++ More..