Result : C4ZWN2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Tautomerase PptA (EC 5.3.2.-) |
| NCBI Accession ID | CP001396.1 |
| Organism | Escherichia coli (strain K12 / MC4100 / BW2952) |
| Left | 1423135 |
| Right | 1423368 |
| Strand | + |
| Nucleotide Sequence | ATGCCGCACATCGACATTAAATGTTTTCCGCGTGAACTGGACGAACAACAAAAAGCAGCACTTGCTGCAGATATTACCGACGTTATTATTCGTCATCTGAACAGTAAAGACAGTTCGATAAGCATTGCTCTACAGCAGATTCAACCAGAATCTTGGCAAGCTATCTGGGATGCCGAAATCGCGCCCCAAATGGAGGCTTTGATAAAGAAACCTGGTTATAGCATGAATGCTTAA |
| Sequence | MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEIAPQMEALIKKPGYSMNA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 19376874 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | C4ZWN2 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1533052 | 1533285 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2052425 | 2052652 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2225105 | 2225332 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 504008 | 504235 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 1523187 | 1523414 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 2368924 | 2369151 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 7 | 3171536 | 3171763 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 8 | 980510 | 980737 | - | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 2869844 | 2870071 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 10 | 2456994 | 2457221 | + | NZ_CP054254.1 | Klebsiella variicola |
| 11 | 159308 | 159535 | - | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 4852676 | 4852903 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 13 | 2458660 | 2458890 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 14 | 2888063 | 2888290 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 15 | 4337645 | 4337875 | + | NZ_CP026047.1 | Raoultella planticola |
| 16 | 2292945 | 2293172 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 17 | 2426012 | 2426242 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 18 | 82712 | 82942 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 19 | 3064953 | 3065180 | - | NZ_CP050508.1 | Raoultella terrigena |
| 20 | 1233415 | 1233645 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 21 | 2427470 | 2427697 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 22 | 660095 | 660325 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 23 | 2683397 | 2683627 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 1015947 | 1016177 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 25 | 2940457 | 2940684 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 26 | 2458620 | 2458850 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 27 | 2702309 | 2702536 | - | NZ_CP041247.1 | Raoultella electrica |
| 28 | 2435895 | 2436125 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 29 | 2452341 | 2452571 | - | NC_015968.1 | Enterobacter soli |
| 30 | 2432050 | 2432280 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 31 | 2694572 | 2694802 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 32 | 3121887 | 3122114 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 33 | 329153 | 329383 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 34 | 3137242 | 3137472 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 35 | 1874115 | 1874345 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 36 | 2479981 | 2480211 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 37 | 690944 | 691174 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 38 | 2265601 | 2265831 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 39 | 2427922 | 2428152 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 40 | 3826258 | 3826485 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 41 | 2344202 | 2344432 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 42 | 3473169 | 3473402 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 43 | 1664942 | 1665172 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 44 | 3948490 | 3948720 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 45 | 1295393 | 1295623 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 46 | 2076444 | 2076674 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 47 | 2141671 | 2141901 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 48 | 1922750 | 1922980 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 49 | 2374456 | 2374686 | - | NZ_CP023525.1 | Cedecea neteri |
| 50 | 2140184 | 2140414 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 51 | 3655893 | 3656123 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 52 | 2072493 | 2072723 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 53 | 20246 | 20476 | + | NZ_CP015581.1 | Tatumella citrea |
| 54 | 2476002 | 2476232 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 55 | 3999365 | 3999595 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 56 | 2304287 | 2304517 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 57 | 1217416 | 1217646 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 58 | 64485 | 64715 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 59 | 2614710 | 2614940 | + | NZ_CP025799.1 | Dickeya zeae |
| 60 | 2130225 | 2130455 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
++ More..