Result : C4ZTE1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Anti-adapter protein IraP |
| NCBI Accession ID | CP001396.1 |
| Organism | Escherichia coli (strain K12 / MC4100 / BW2952) |
| Left | 303369 |
| Right | 303629 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAATCTCATTGCTGAGTTGTTATTTAAGCTTGCCCAAAAAGAAGAAGAGTCGAAAGAACTGTGTGCGCAGGTAGAAGCTTTGGAGATTATCGTCACTGCAATGCTTCGCAATATGGCGCAAAATGACCAACAGCGGTTGATTGATCAGGTAGAGGGGGCGCTGTACGAGGTAAAGCCCGATGCCAGCATTCCTGACGACGATACGGAGCTGCTGCGCGATTACGTAAAGAAGTTATTGAAGCATCCTCGTCAGTAA |
| Sequence | MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ |
| Source of smORF | Swiss-Prot |
| Function | Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS especially during phosphate starvation, but also in stationary phase and during nitrogen starvation. Its effect on RpoS stability is due to its interaction with RssB, which probably blocks the interaction of RssB with RpoS, and the consequent delivery of the RssB-RpoS complex to the ClpXP protein degradation pathway. {ECO:0000255|HAMAP-Rule:MF_01198}. |
| Pubmed ID | 19376874 |
| Domain | CDD:416356 |
| Functional Category | Others |
| Uniprot ID | C4ZTE1 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 401386 | 401646 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 461166 | 461426 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3262962 | 3263222 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 254711 | 254971 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1043203 | 1043463 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 414481 | 414741 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2978279 | 2978539 | + | NZ_CP053416.1 | Salmonella bongori |
| 8 | 2592112 | 2592372 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 437106 | 437366 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 10 | 4521574 | 4521834 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 1693468 | 1693728 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 12 | 477992 | 478252 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 13 | 2585397 | 2585657 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 14 | 121406 | 121666 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 15 | 962316 | 962576 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 16 | 1546834 | 1547094 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 17 | 1003731 | 1003991 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 18 | 1013640 | 1013900 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 19 | 2576869 | 2577129 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 20 | 3777437 | 3777697 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 21 | 958540 | 958800 | + | NC_015968.1 | Enterobacter soli |
| 22 | 3516411 | 3516671 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 23 | 1203197 | 1203457 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 4378470 | 4378730 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 25 | 2388958 | 2389218 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 26 | 3096199 | 3096459 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 27 | 2987792 | 2988052 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 28 | 1042282 | 1042542 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 29 | 1056508 | 1056768 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 30 | 2015211 | 2015471 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 31 | 1046982 | 1047242 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 32 | 1048084 | 1048344 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 33 | 1046927 | 1047187 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 34 | 3481773 | 3482033 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 35 | 4721813 | 4722073 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 36 | 3601932 | 3602192 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 37 | 3602298 | 3602558 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 38 | 3555699 | 3555959 | - | NZ_LR134201.1 | Cedecea lapagei |
| 39 | 4072921 | 4073181 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 40 | 3866108 | 3866368 | - | NZ_CP023525.1 | Cedecea neteri |
| 41 | 4697950 | 4698210 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 42 | 4777894 | 4778154 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 43 | 4144141 | 4144401 | - | NZ_CP041247.1 | Raoultella electrica |
| 44 | 915188 | 915448 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 45 | 2870294 | 2870554 | + | NZ_CP026047.1 | Raoultella planticola |
| 46 | 4374535 | 4374795 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 47 | 1957826 | 1958086 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 48 | 3537998 | 3538258 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 49 | 4185510 | 4185770 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 50 | 4479363 | 4479623 | - | NZ_CP050508.1 | Raoultella terrigena |
| 51 | 1116807 | 1117067 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 52 | 1152840 | 1153097 | + | NZ_CP061511.1 | Mixta calida |
| 53 | 1123119 | 1123379 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 54 | 4355573 | 4355833 | - | NZ_CP054254.1 | Klebsiella variicola |
| 55 | 4087750 | 4088010 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 56 | 3137288 | 3137539 | - | NZ_CP038853.1 | Pantoea vagans |
| 57 | 2720306 | 2720566 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 58 | 440555 | 440809 | - | NZ_CP019706.1 | Pantoea alhagi |
| 59 | 907725 | 907976 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 60 | 396335 | 396589 | + | NZ_CP028271.1 | Mixta intestinalis |
| 61 | 1230124 | 1230378 | + | NZ_CP026377.1 | Mixta gaviniae |
| 62 | 3860747 | 3861001 | + | NZ_CP049115.1 | Pantoea stewartii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10954.10 | 0.74 | 45 | 3974.5 | opposite-strand | Protein of unknown function (DUF2755) |
| 2 | PF10953.10 | 0.77 | 47 | 3483.5 | same-strand | Protein of unknown function (DUF2754) |
| 3 | PF07478.15 | 0.84 | 51 | 2399.0 | opposite-strand | D-ala D-ala ligase C-terminus |
| 4 | PF01820.23 | 0.84 | 51 | 2399.0 | opposite-strand | D-ala D-ala ligase N-terminus |
| 5 | PF02222.24 | 0.84 | 51 | 2399.0 | opposite-strand | ATP-grasp domain |
| 6 | PF00245.22 | 0.62 | 38 | 100 | same-strand | Alkaline phosphatase |
| 7 | PF07769.16 | 0.84 | 51 | 1609.0 | same-strand | psiF repeat |
| 8 | PF14748.8 | 0.97 | 59 | 2220.5 | opposite-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 9 | PF03807.19 | 0.97 | 59 | 2220.5 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
| 10 | PF02639.16 | 0.92 | 56 | 4037 | same-strand | Uncharacterized BCR, YaiI/YqxD family COG1671 |
| 11 | PF02786.19 | 0.79 | 48 | 2414.5 | opposite-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 12 | PF06904.14 | 0.62 | 38 | 1603.5 | same-strand | Extensin-like protein C-terminus |
| 13 | PF12832.9 | 0.64 | 39 | 262 | same-strand | MFS 1 like family |
++ More..