Result : C4ZBT6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP001107.1 |
| Organism | Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990) (Eubacterium rectale) |
| Left | 392327 |
| Right | 392509 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGATAGAGTTAAAGTTACATTAATCAAATCTACAATCGGTGCTGTTCCTAAGAACAAGAAGACTATTGAGGCTCTTGGTCTTACTAAGTTAGGCAAAACTGTAGAGTTACCAAACAATGCAGCTACACAGGGAGCTGTTCGCAAAGTAGCACCATACGTAAAAGTAGAAGAAGTTTAA |
| Sequence | MADRVKVTLIKSTIGAVPKNKKTIEALGLTKLGKTVELPNNAATQGAVRKVAPYVKVEEV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 19321416 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C4ZBT6 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 77
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3872866 | 3873051 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 2 | 3133498 | 3133683 | - | NZ_LR699011.1 | Roseburia hominis |
| 3 | 5085641 | 5085823 | - | NZ_CP039126.1 | Blautia producta |
| 4 | 2510859 | 2511041 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 5 | 509591 | 509773 | + | NZ_CP030280.1 | Blautia argi |
| 6 | 3239868 | 3240050 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 7 | 372653 | 372835 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 8 | 343539 | 343721 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 9 | 3433869 | 3434048 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 10 | 499940 | 500119 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 11 | 1987262 | 1987441 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 12 | 340756 | 340938 | + | NZ_LN879430.1 | Herbinix luporum |
| 13 | 4056304 | 4056486 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 14 | 2741311 | 2741493 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 15 | 1621222 | 1621404 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 16 | 1610282 | 1610464 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 17 | 412266 | 412448 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 18 | 2575324 | 2575506 | + | NZ_CP070062.1 | Coprococcus comes |
| 19 | 5609639 | 5609821 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 20 | 1308004 | 1308186 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 21 | 770131 | 770289 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 22 | 761624 | 761809 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 23 | 3727534 | 3727716 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 24 | 580812 | 580967 | + | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 25 | 4492886 | 4493068 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 26 | 251661 | 251843 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 27 | 4496890 | 4497072 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 28 | 718492 | 718674 | + | NZ_CP048649.1 | Aminipila butyrica |
| 29 | 207849 | 208031 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 30 | 1804813 | 1804998 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 31 | 481339 | 481518 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 32 | 3852710 | 3852895 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 33 | 314729 | 314914 | + | NZ_CP027563.1 | Weissella confusa |
| 34 | 278102 | 278287 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 35 | 40541 | 40726 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 36 | 346114 | 346296 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 37 | 341410 | 341592 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 38 | 344356 | 344538 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 39 | 317422 | 317601 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 40 | 335944 | 336126 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 41 | 4127024 | 4127206 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 42 | 3815134 | 3815313 | - | NZ_CP009687.1 | Clostridium aceticum |
| 43 | 2121905 | 2122087 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 44 | 219199 | 219381 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 45 | 398181 | 398366 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 46 | 3194240 | 3194422 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 47 | 213630 | 213812 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 48 | 213091 | 213273 | + | NZ_CP065135.1 | Halomonas venusta |
| 49 | 2456334 | 2456501 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 50 | 698126 | 698308 | - | NZ_CP059082.1 | Halomonas titanicae |
| 51 | 1394818 | 1395000 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 52 | 1313472 | 1313654 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 53 | 1560054 | 1560236 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 54 | 3780342 | 3780521 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 55 | 6336798 | 6336989 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 56 | 920698 | 920883 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 57 | 3928124 | 3928306 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 58 | 286799 | 286975 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 59 | 2935636 | 2935812 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 60 | 186526 | 186702 | - | NZ_CP046314.1 | Gemella morbillorum |
| 61 | 1754743 | 1754919 | - | NZ_LR134484.1 | Gemella haemolysans |
| 62 | 2300503 | 2300682 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 63 | 373436 | 373615 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 64 | 90340 | 90501 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 65 | 2327527 | 2327688 | + | NZ_CP041660.1 | Catenovulum sediminis |
| 66 | 2583965 | 2584147 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 67 | 4334477 | 4334653 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 68 | 749933 | 750115 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 69 | 297739 | 297921 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 70 | 859603 | 859776 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 71 | 1771625 | 1771804 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 72 | 250649 | 250828 | - | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 73 | 248192 | 248371 | - | NZ_CP040106.1 | Echinicola rosea |
| 74 | 968209 | 968391 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 75 | 431649 | 431828 | + | NZ_CP014164.1 | Aerococcus viridans |
| 76 | 3227249 | 3227410 | + | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 77 | 214866 | 215042 | - | NZ_CP034930.1 | Apibacter raozihei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00406.24 | 0.73 | 56 | 1827.0 | same-strand | Adenylate kinase |
| 2 | PF13207.8 | 0.73 | 56 | 1827.0 | same-strand | AAA domain |
| 3 | PF05191.16 | 0.69 | 53 | 1832 | same-strand | Adenylate kinase, active site lid |
| 4 | PF00344.22 | 0.99 | 76 | 466.0 | same-strand | SecY |
| 5 | PF00828.21 | 0.99 | 76 | 26.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 6 | PF03719.17 | 1.0 | 77 | 14 | same-strand | Ribosomal protein S5, C-terminal domain |
| 7 | PF00333.22 | 1.0 | 77 | 14 | same-strand | Ribosomal protein S5, N-terminal domain |
| 8 | PF00861.24 | 1.0 | 77 | 539 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 9 | PF00347.25 | 1.0 | 77 | 929 | same-strand | Ribosomal protein L6 |
| 10 | PF00410.21 | 1.0 | 77 | 1503 | same-strand | Ribosomal protein S8 |
| 11 | PF00253.23 | 0.91 | 70 | 1938.0 | same-strand | Ribosomal protein S14p/S29e |
++ More..