Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP001107.1 |
Organism | Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990) (Eubacterium rectale) |
Left | 1558675 |
Right | 1558935 |
Strand | + |
Nucleotide Sequence | ATGATACATCCATCGTATGTAGAGTTAATGAAGGTAGTAAACAACAATGTAGAGATAGGTGAAGAGCCGGTAGTAAACAGCCGTTATTCTATCGTTATTGCTGCAGCAAAGCGTGCACGTCAGATTATTGATGGTGCAGAACCACTTATCGCACACCCTAAGTGCAATAAGCCATTATCTATTGCTGTAGAGGAGCTGTACACGGGAGCTGTCAGAATCGTCTCAGATGATGAGGATTTAAACGAAGGCGAAGAGGCTTAA |
Sequence | MIHPSYVELMKVVNNNVEIGEEPVVNSRYSIVIAAAKRARQIIDGAEPLIAHPKCNKPLSIAVEELYTGAVRIVSDDEDLNEGEEA |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 19321416 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | C4Z9X7 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2047605 | 2047850 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
2 | 3531402 | 3531650 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
3 | 1607177 | 1607425 | + | NZ_LR699011.1 | Roseburia hominis |
4 | 3518313 | 3518558 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
5 | 1106628 | 1106882 | + | NZ_LN879430.1 | Herbinix luporum |
6 | 2921260 | 2921505 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
7 | 1595780 | 1596052 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
8 | 374284 | 374523 | - | NZ_LT990039.1 | Massilistercora timonensis |
9 | 1235163 | 1235405 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
10 | 627651 | 627893 | - | NZ_CP070062.1 | Coprococcus comes |
11 | 2823266 | 2823505 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
12 | 2104618 | 2104872 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
13 | 3017703 | 3017966 | + | NZ_CP022464.2 | Enterocloster bolteae |
14 | 435415 | 435660 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
15 | 1243280 | 1243525 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
16 | 3116945 | 3117205 | - | NZ_CP039126.1 | Blautia producta |
17 | 1319993 | 1320262 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
18 | 2386199 | 2386492 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
19 | 2134413 | 2134652 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
20 | 1421298 | 1421537 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
21 | 22941 | 23159 | + | NZ_LR130778.1 | Petrocella atlantisensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03755.15 | 1.0 | 21 | 664 | same-strand | YicC-like family, N-terminal region |
2 | PF08340.13 | 1.0 | 21 | 664 | same-strand | Domain of unknown function (DUF1732) |
3 | PF00625.23 | 0.81 | 17 | 7 | same-strand | Guanylate kinase |
4 | PF13238.8 | 0.67 | 14 | 6.5 | same-strand | AAA domain |
5 | PF00919.22 | 0.62 | 13 | 73 | same-strand | Uncharacterized protein family UPF0004 |
6 | PF04055.23 | 0.67 | 14 | 74.5 | same-strand | Radical SAM superfamily |
7 | PF18693.3 | 0.62 | 13 | 73 | same-strand | TRAM domain |
8 | PF01066.23 | 0.62 | 13 | 1400 | same-strand | CDP-alcohol phosphatidyltransferase |