Result : C4Z9Q2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP001107.1 |
| Organism | Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990) (Eubacterium rectale) |
| Left | 90792 |
| Right | 91073 |
| Strand | + |
| Nucleotide Sequence | ATGGGTATAATGGATTTATTTAAAAAGAAATCTTCTGGTAATGTTGCAAAGGATCGCCTGAAGCTGGTGCTGGTTTCTGACCGTGCAAACTGCTCATCGGAGATGATGGAGATGATGAAAAGGGATATCATTGAGGTTATTTCCCGCTATATGGATATTGATGCGGAAGCTCTTGATGTGAAAATCACAGAGACAGAGTCTGATTCTAACAACGGAATGGTTCCGGCACTTGTTGCCAATATTCCTATCCGTGACATGAAGCATCGTCCGGATCCAAGATAG |
| Sequence | MGIMDLFKKKSSGNVAKDRLKLVLVSDRANCSSEMMEMMKRDIIEVISRYMDIDAEALDVKITETESDSNNGMVPALVANIPIRDMKHRPDPR |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 19321416 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | C4Z9Q2 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1909240 | 1909515 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 2 | 2920640 | 2920912 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 3 | 1021218 | 1021493 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 4 | 3166971 | 3167246 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 5 | 3795242 | 3795517 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 6 | 1240604 | 1240879 | + | NZ_LN879430.1 | Herbinix luporum |
| 7 | 108278 | 108562 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 8 | 113357 | 113632 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 9 | 1731643 | 1731921 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 10 | 2309630 | 2309896 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 11 | 1349647 | 1349913 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 12 | 5606512 | 5606787 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 13 | 1859305 | 1859586 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 14 | 2512778 | 2513062 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 15 | 1210165 | 1210449 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 16 | 3505256 | 3505540 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 17 | 370880 | 371113 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 18 | 2365141 | 2365425 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 19 | 1714081 | 1714368 | + | NZ_CP009687.1 | Clostridium aceticum |
| 20 | 1860876 | 1861163 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 21 | 1312676 | 1312957 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 22 | 1431201 | 1431485 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 23 | 2031924 | 2032205 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 24 | 3079523 | 3079807 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 25 | 1155382 | 1155672 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 26 | 2317805 | 2318089 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 27 | 2087142 | 2087426 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 28 | 917898 | 918176 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 29 | 903801 | 904079 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 30 | 1546473 | 1546745 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 31 | 1798667 | 1798933 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 32 | 735677 | 735958 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 33 | 1474381 | 1474656 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 34 | 2015793 | 2016095 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 35 | 897671 | 897937 | + | NC_008593.1 | Clostridium novyi NT |
| 36 | 1410011 | 1410292 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 37 | 1155975 | 1156250 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 38 | 1288148 | 1288405 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 39 | 1026198 | 1026473 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 40 | 1567110 | 1567391 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 41 | 1621315 | 1621590 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 42 | 1157853 | 1158128 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 43 | 198006 | 198284 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 44 | 3373066 | 3373332 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 45 | 3632813 | 3633082 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 46 | 3322310 | 3322537 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 47 | 3537109 | 3537384 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 48 | 668636 | 668926 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 49 | 477456 | 477713 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 50 | 487025 | 487321 | + | NZ_CP017237.1 | Moorella thermoacetica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010001.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03775.18 | 1.0 | 50 | 856.0 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 2 | PF13614.8 | 0.98 | 49 | 18 | same-strand | AAA domain |
| 3 | PF10609.11 | 0.96 | 48 | 18.5 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 4 | PF01656.25 | 1.0 | 50 | 18.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF02142.24 | 0.64 | 32 | 1150.0 | same-strand | MGS-like domain |
| 6 | PF01098.21 | 0.64 | 32 | 87.5 | same-strand | Cell cycle protein |
| 7 | PF00905.24 | 0.82 | 41 | 1613 | same-strand | Penicillin binding protein transpeptidase domain |
| 8 | PF03717.17 | 0.88 | 44 | 1618 | same-strand | Penicillin-binding Protein dimerisation domain |
| 9 | PF04093.14 | 0.84 | 42 | 4327.0 | same-strand | rod shape-determining protein MreD |
| 10 | PF04085.16 | 0.82 | 41 | 4548 | same-strand | rod shape-determining protein MreC |
++ More..