Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AP010904.1 |
Organism | Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) |
Left | 2721169 |
Right | 2721432 |
Strand | - |
Nucleotide Sequence | GTGAGCGTGAAGGAAGAAAGCTTTGAAAAGGCGCTGGCGCGCCTGGAGCGCATAGCCGTCGCCCTGGAAGCCGGGGACGTGCCCCTGGAAAAGGGCGTGGCGCTGTATAAAGAGGGCATGGGACTTGTGGCCTCGTGCCGCAAGCGCCTGGAGGCGGCCCGGCTGGAAATCAGTCTGGCCGGCGAGGACGGCGCTGTGGTCCCGTTTGACGTTGCCGATGACGAGGCCGCTCGCGACGGCGGGCCGGCCGGGGAGGAGTCGTGA |
Sequence | MSVKEESFEKALARLERIAVALEAGDVPLEKGVALYKEGMGLVASCRKRLEAARLEISLAGEDGAVVPFDVADDEAARDGGPAGEES |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 19675025 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | C4XTC8 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2721169 | 2721432 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
2 | 2128020 | 2128283 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
3 | 1183680 | 1183946 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
4 | 2243208 | 2243450 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
5 | 1371577 | 1371840 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01916.19 | 0.6 | 3 | 4389 | same-strand | Deoxyhypusine synthase |
2 | PF13292.8 | 1.0 | 5 | 1014 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
3 | PF02779.26 | 1.0 | 5 | 1014 | same-strand | Transketolase, pyrimidine binding domain |
4 | PF02780.22 | 1.0 | 5 | 1014 | same-strand | Transketolase, C-terminal domain |
5 | PF00348.19 | 1.0 | 5 | -3 | same-strand | Polyprenyl synthetase |
6 | PF02601.17 | 1.0 | 5 | -3 | same-strand | Exonuclease VII, large subunit |
7 | PF13742.8 | 1.0 | 5 | -3 | same-strand | OB-fold nucleic acid binding domain |
8 | PF01336.27 | 0.6 | 3 | -3 | same-strand | OB-fold nucleic acid binding domain |
9 | PF00587.27 | 0.8 | 4 | 2208.5 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
10 | PF04073.17 | 0.8 | 4 | 2208.5 | same-strand | Aminoacyl-tRNA editing domain |
11 | PF03129.22 | 0.8 | 4 | 2208.5 | same-strand | Anticodon binding domain |
12 | PF04551.16 | 0.8 | 4 | 3949.5 | same-strand | GcpE protein |