Result : C4XTC8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AP010904.1 |
| Organism | Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) |
| Left | 2721169 |
| Right | 2721432 |
| Strand | - |
| Nucleotide Sequence | GTGAGCGTGAAGGAAGAAAGCTTTGAAAAGGCGCTGGCGCGCCTGGAGCGCATAGCCGTCGCCCTGGAAGCCGGGGACGTGCCCCTGGAAAAGGGCGTGGCGCTGTATAAAGAGGGCATGGGACTTGTGGCCTCGTGCCGCAAGCGCCTGGAGGCGGCCCGGCTGGAAATCAGTCTGGCCGGCGAGGACGGCGCTGTGGTCCCGTTTGACGTTGCCGATGACGAGGCCGCTCGCGACGGCGGGCCGGCCGGGGAGGAGTCGTGA |
| Sequence | MSVKEESFEKALARLERIAVALEAGDVPLEKGVALYKEGMGLVASCRKRLEAARLEISLAGEDGAVVPFDVADDEAARDGGPAGEES |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 19675025 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | C4XTC8 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2721169 | 2721432 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 2 | 2128020 | 2128283 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 3 | 1183680 | 1183946 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 4 | 2243208 | 2243450 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 5 | 1371577 | 1371840 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012796.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01916.19 | 0.6 | 3 | 4389 | same-strand | Deoxyhypusine synthase |
| 2 | PF13292.8 | 1.0 | 5 | 1014 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 1.0 | 5 | 1014 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 1.0 | 5 | 1014 | same-strand | Transketolase, C-terminal domain |
| 5 | PF00348.19 | 1.0 | 5 | -3 | same-strand | Polyprenyl synthetase |
| 6 | PF02601.17 | 1.0 | 5 | -3 | same-strand | Exonuclease VII, large subunit |
| 7 | PF13742.8 | 1.0 | 5 | -3 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF01336.27 | 0.6 | 3 | -3 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF00587.27 | 0.8 | 4 | 2208.5 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 10 | PF04073.17 | 0.8 | 4 | 2208.5 | same-strand | Aminoacyl-tRNA editing domain |
| 11 | PF03129.22 | 0.8 | 4 | 2208.5 | same-strand | Anticodon binding domain |
| 12 | PF04551.16 | 0.8 | 4 | 3949.5 | same-strand | GcpE protein |
++ More..