Result : C4XLX5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | AP010904.1 |
| Organism | Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) |
| Left | 1342068 |
| Right | 1342358 |
| Strand | + |
| Nucleotide Sequence | ATGGAATACGCTAACATCCTTTTGAAGCCGGTTATTTCCGAGAAAGCCACGATGGTGAAGGATGCCGCCAATCAGGTGGTGTTTTTTGTCCATCCCGCTGCCAACAAGATCGAGATCGCCAAGGCTGTGGAAAAGGCTTTCTCTGTTACGGTCAAGGGCGTGCGCGTGGTCAAGCACAAAAGCCTCGCCCGTTCCCGCATGGGACGCGTGACCGGCCGGATTCCGGGCTACAAAAAAGCCTACGTGACCCTGGCCCAGGGCGATAAAATCGAGTTCTTCGAAGGGGTTTAG |
| Sequence | MEYANILLKPVISEKATMVKDAANQVVFFVHPAANKIEIAKAVEKAFSVTVKGVRVVKHKSLARSRMGRVTGRIPGYKKAYVTLAQGDKIEFFEGV |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 19675025 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | C4XLX5 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 84
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3394688 | 3394978 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 2 | 1342068 | 1342358 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 3 | 2449731 | 2450021 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 4 | 311308 | 311598 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 5 | 4118956 | 4119246 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 6 | 441744 | 442034 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 7 | 2356787 | 2357077 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 8 | 2280976 | 2281266 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 9 | 1259804 | 1260091 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 10 | 2457412 | 2457702 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 11 | 1478117 | 1478404 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 12 | 1321309 | 1321599 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 13 | 2604611 | 2604901 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 14 | 3800207 | 3800500 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 15 | 1398361 | 1398651 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 16 | 3150277 | 3150567 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 17 | 224006 | 224296 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 18 | 2351329 | 2351619 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 19 | 6074945 | 6075235 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 20 | 1541248 | 1541484 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 21 | 471303 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 22 | 925762 | 926034 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 23 | 3234802 | 3235092 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 24 | 478873 | 479112 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 25 | 4416538 | 4416807 | - | NZ_CP060092.1 | Teredinibacter purpureus |
| 26 | 650689 | 650979 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 27 | 255143 | 255412 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 28 | 2432320 | 2432601 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 29 | 5175520 | 5175792 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 30 | 809284 | 809568 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 31 | 3154773 | 3155045 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 32 | 488343 | 488618 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 33 | 2961768 | 2962004 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 34 | 2442162 | 2442398 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 35 | 2464020 | 2464277 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 36 | 1994871 | 1995146 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 37 | 2629297 | 2629530 | - | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 38 | 3516643 | 3516879 | - | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 39 | 2202086 | 2202361 | + | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 40 | 595963 | 596196 | + | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 41 | 558064 | 558351 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 42 | 3257771 | 3258049 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 43 | 1574348 | 1574581 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 44 | 2104552 | 2104791 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 45 | 5641969 | 5642265 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 46 | 2748876 | 2749118 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 47 | 3445380 | 3445676 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 48 | 1970276 | 1970554 | - | NZ_CP016604.1 | Otariodibacter oris |
| 49 | 881956 | 882231 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 50 | 1607021 | 1607299 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 51 | 2004654 | 2004932 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 52 | 53670 | 53909 | + | NZ_CP023276.1 | Polynucleobacter difficilis |
| 53 | 1246238 | 1246534 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 54 | 2802158 | 2802394 | - | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 55 | 2888851 | 2889111 | - | NZ_CP046909.1 | Paraburkholderia acidiphila |
| 56 | 2915795 | 2916055 | - | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 57 | 2992285 | 2992545 | - | NZ_CP009795.1 | Burkholderia dolosa AU0158 |
| 58 | 420009 | 420269 | + | NZ_CP009832.1 | Burkholderia multivorans ATCC BAA-247 |
| 59 | 332839 | 333099 | + | NZ_CP013398.1 | Burkholderia seminalis |
| 60 | 317978 | 318238 | + | NZ_CP013401.1 | Burkholderia metallica |
| 61 | 1619803 | 1620063 | + | NZ_CP011503.1 | Burkholderia pyrrocinia |
| 62 | 330330 | 330590 | + | NZ_CP013450.1 | Burkholderia cenocepacia |
| 63 | 326355 | 326615 | + | NZ_CP045235.1 | Burkholderia cepacia |
| 64 | 323705 | 323965 | + | NC_007510.1 | Burkholderia lata |
| 65 | 412731 | 412991 | + | NZ_CP013459.1 | Burkholderia stagnalis |
| 66 | 2001596 | 2001856 | + | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 67 | 3295958 | 3296218 | - | NZ_CP026111.1 | Paraburkholderia terrae |
| 68 | 2386489 | 2386725 | + | NZ_CP015958.1 | Paraburkholderia caribensis |
| 69 | 3773448 | 3773723 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 70 | 346959 | 347219 | + | NZ_CP020737.1 | Paraburkholderia acidophila |
| 71 | 998680 | 998940 | + | NZ_CP009727.1 | Burkholderia mallei |
| 72 | 2025112 | 2025372 | + | NZ_CP008781.1 | Burkholderia pseudomallei |
| 73 | 3499915 | 3500175 | - | NC_007651.1 | Burkholderia thailandensis E264 |
| 74 | 2677891 | 2678151 | - | NC_021287.1 | Caballeronia insecticola |
| 75 | 3708857 | 3709093 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 76 | 2992660 | 2992896 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 77 | 3691097 | 3691333 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 78 | 4073244 | 4073480 | - | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 79 | 1812819 | 1813055 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 80 | 4512627 | 4512863 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 81 | 1491506 | 1491742 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 82 | 424753 | 425013 | + | NZ_CP013414.1 | Burkholderia ubonensis |
| 83 | 310535 | 310810 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 84 | 2016035 | 2016304 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP026538.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 1.0 | 84 | 2220.0 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 1.0 | 84 | 1483.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 1.0 | 84 | 1483.0 | same-strand | KH domain |
| 4 | PF00237.21 | 1.0 | 84 | 1140.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 1.0 | 84 | 846.0 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 1.0 | 84 | 4.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 1.0 | 84 | 4.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 84 | 33.0 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 1.0 | 84 | 1403.0 | same-strand | Ribosomal protein S10p/S20e |
| 10 | PF00009.29 | 0.83 | 70 | 2338 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03143.19 | 0.74 | 62 | 1962.5 | same-strand | Elongation factor Tu C-terminal domain |
| 12 | PF03144.27 | 0.85 | 71 | 2262 | same-strand | Elongation factor Tu domain 2 |
| 13 | PF01926.25 | 0.71 | 60 | 1981.0 | same-strand | 50S ribosome-binding GTPase |
| 14 | PF03764.20 | 0.8 | 67 | 3150 | same-strand | Elongation factor G, domain IV |
| 15 | PF14492.8 | 0.8 | 67 | 3150 | same-strand | Elongation Factor G, domain III |
| 16 | PF00679.26 | 0.8 | 67 | 3150 | same-strand | Elongation factor G C-terminus |
++ More..