Result : A1TL12
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000512.1 |
| Organism | Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli) |
| Left | 1155741 |
| Right | 1156004 |
| Strand | + |
| Nucleotide Sequence | ATGGGTTCCTTTTCCATCTGGCACTGGCTGATCGTGCTGCTCATCGTGGTGATGGTGTTCGGCACGAAGAAGCTCAAGAACATCGGCTCCGACCTCGGCGGTGCCGTGAAGGGCTTCAAGGACGGCATGAAGGACGGCAGCACGCCGGAGGGCACGCCCGCCTCCACCACCGCCGCCACGCCCCCCGCCGGGCAGGTGACGAACCAGCAGGCGCACGCCGCCGACCCGGGCACGATCGACGTCGAGGCCAAGCACAAGGGCTGA |
| Sequence | MGSFSIWHWLIVLLIVVMVFGTKKLKNIGSDLGGAVKGFKDGMKDGSTPEGTPASTTAATPPAGQVTNQQAHAADPGTIDVEAKHKG |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | A1TL12 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 150
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1155741 | 1156004 | + | NC_008752.1 | Acidovorax citrulli AAC00-1 |
| 2 | 1146593 | 1146856 | + | NC_015138.1 | Acidovorax avenae subsp. avenae ATCC 19860 |
| 3 | 3238140 | 3238382 | - | NZ_CP021359.1 | Acidovorax carolinensis |
| 4 | 2398905 | 2399153 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 5 | 1044703 | 1044951 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 6 | 1026826 | 1027083 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 7 | 3417669 | 3417929 | - | NZ_CP054840.1 | Acidovorax antarcticus |
| 8 | 4177142 | 4177390 | + | NZ_CP060790.1 | Acidovorax monticola |
| 9 | 4411668 | 4411910 | - | NZ_CP019236.1 | Rhodoferax koreense |
| 10 | 2525584 | 2525829 | + | NZ_CP027669.1 | Simplicispira suum |
| 11 | 6024714 | 6024953 | - | NZ_CP065748.1 | Delftia lacustris |
| 12 | 5979803 | 5980042 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 13 | 749626 | 749880 | + | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 14 | 2044277 | 2044525 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 15 | 3849820 | 3850053 | - | NZ_CP027666.1 | Ottowia oryzae |
| 16 | 3149365 | 3149625 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 17 | 4105183 | 4105416 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 18 | 1573031 | 1573270 | - | NZ_CP060783.1 | Diaphorobacter aerolatus |
| 19 | 2664755 | 2664988 | - | NZ_CP013119.1 | Alcaligenes faecalis |
| 20 | 3388419 | 3388655 | - | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 21 | 3110056 | 3110286 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 22 | 3102549 | 3102785 | - | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 23 | 3314028 | 3314279 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 24 | 161333 | 161587 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 25 | 3682471 | 3682704 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 26 | 3214402 | 3214638 | - | NZ_CP026111.1 | Paraburkholderia terrae |
| 27 | 2468021 | 2468257 | + | NZ_CP015958.1 | Paraburkholderia caribensis |
| 28 | 141096 | 141323 | - | NC_010170.1 | Bordetella petrii |
| 29 | 3867193 | 3867420 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 30 | 3923525 | 3923752 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 31 | 136175 | 136402 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 32 | 1386612 | 1386863 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 33 | 4050094 | 4050330 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 34 | 3468769 | 3469008 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 35 | 2066229 | 2066471 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 36 | 3470765 | 3471022 | - | NZ_CP068285.1 | Ralstonia syzygii subsp. celebesensis |
| 37 | 104330 | 104572 | + | NZ_CP007501.1 | Polynucleobacter duraquae |
| 38 | 1571354 | 1571593 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 39 | 4776389 | 4776634 | - | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 40 | 801657 | 801899 | - | NZ_CP020046.1 | Thiomonas intermedia |
| 41 | 240168 | 240410 | + | NZ_CP054624.1 | Cupriavidus gilardii |
| 42 | 1733104 | 1733346 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 43 | 3388827 | 3389072 | - | NZ_CP028901.1 | Algicoccus marinus |
| 44 | 5175616 | 5175861 | - | NZ_CP010897.2 | Pandoraea vervacti |
| 45 | 143362 | 143583 | - | NZ_CP016440.1 | Bordetella pseudohinzii |
| 46 | 268530 | 268769 | - | NZ_LT907988.1 | Orrella dioscoreae |
| 47 | 4268841 | 4269080 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 48 | 5416964 | 5417209 | - | NZ_CP010310.2 | Pandoraea pulmonicola |
| 49 | 98674 | 98904 | + | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 50 | 1763217 | 1763438 | - | NZ_CP021395.1 | Bordetella hinzii |
| 51 | 2605925 | 2606161 | - | NC_021287.1 | Caballeronia insecticola |
| 52 | 1222692 | 1222934 | + | NZ_CP021455.1 | Comamonas serinivorans |
| 53 | 3610743 | 3610985 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 54 | 1745792 | 1746043 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 55 | 4431071 | 4431310 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 56 | 157471 | 157692 | - | NZ_CP043146.1 | Bordetella holmesii |
| 57 | 314424 | 314675 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 58 | 2356126 | 2356362 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 59 | 2046093 | 2046341 | + | NZ_CP040882.1 | Sutterella faecalis |
| 60 | 2810456 | 2810695 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 61 | 5142621 | 5142863 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 62 | 5297781 | 5298023 | - | NZ_LT906435.1 | Pandoraea sputorum |
| 63 | 1699128 | 1699364 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 64 | 1029108 | 1029341 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 65 | 4941666 | 4941911 | - | NC_023018.2 | Pandoraea pnomenusa |
| 66 | 4815769 | 4816005 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 67 | 5727834 | 5728079 | - | NZ_CP013480.3 | Pandoraea norimbergensis |
| 68 | 3632607 | 3632846 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 69 | 5218152 | 5218382 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 70 | 2484006 | 2484257 | - | NZ_CP068055.1 | Sutterella wadsworthensis |
| 71 | 3993251 | 3993490 | - | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 72 | 191553 | 191780 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 73 | 1512228 | 1512485 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 74 | 2940608 | 2940841 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 75 | 2840758 | 2840997 | - | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 76 | 139179 | 139412 | - | NZ_CP016172.1 | Bordetella flabilis |
| 77 | 2727842 | 2728084 | - | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 78 | 3072030 | 3072269 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 79 | 2904553 | 2904783 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 80 | 2732540 | 2732767 | - | NZ_LR134302.1 | Achromobacter spanius |
| 81 | 434114 | 434362 | + | NZ_CP013481.2 | Pandoraea apista |
| 82 | 179473 | 179697 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 83 | 878090 | 878320 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 84 | 3195466 | 3195699 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 85 | 1226399 | 1226647 | + | NZ_CP047385.1 | Pandoraea fibrosis |
| 86 | 4722505 | 4722756 | - | NZ_CP043575.1 | Comamonas koreensis |
| 87 | 2571551 | 2571784 | + | NZ_CP035900.1 | Burkholderia glumae |
| 88 | 3219701 | 3219943 | + | NZ_CP017561.1 | Paraburkholderia sprentiae WSM5005 |
| 89 | 863556 | 863798 | + | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 90 | 560719 | 560979 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 91 | 2884402 | 2884638 | - | NZ_CP049134.1 | Paraburkholderia tropica |
| 92 | 1192249 | 1192476 | - | NZ_CP029210.1 | Aquabacterium olei |
| 93 | 780550 | 780774 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 94 | 104445 | 104666 | + | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 95 | 374725 | 374958 | + | NZ_CP002580.1 | Burkholderia plantarii |
| 96 | 3054259 | 3054516 | - | NZ_CP027792.1 | Pulveribacter suum |
| 97 | 86380 | 86607 | + | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 98 | 5077877 | 5078122 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 99 | 1115163 | 1115399 | + | NZ_CP046910.1 | Paraburkholderia acidiphila |
| 100 | 1121121 | 1121354 | + | NZ_CP040709.1 | Inhella inkyongensis |
| 101 | 2815168 | 2815404 | - | NZ_CP046909.1 | Paraburkholderia acidiphila |
| 102 | 1877068 | 1877283 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 103 | 2079009 | 2079245 | + | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 104 | 2724522 | 2724749 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 105 | 534815 | 535048 | + | NZ_CP009727.1 | Burkholderia mallei |
| 106 | 2099392 | 2099625 | + | NZ_CP008781.1 | Burkholderia pseudomallei |
| 107 | 4303137 | 4303358 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 108 | 641492 | 641710 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 109 | 647793 | 648032 | + | NZ_CP018839.1 | Thauera chlorobenzoica |
| 110 | 1724977 | 1725195 | + | NC_012968.1 | Methylotenera mobilis JLW8 |
| 111 | 2549942 | 2550193 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 112 | 1488815 | 1489042 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 113 | 654066 | 654302 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 114 | 682806 | 683039 | + | NZ_CP043046.1 | Pigmentiphaga aceris |
| 115 | 3862540 | 3862770 | - | NZ_CP064781.1 | Azospira restricta |
| 116 | 190555 | 190791 | - | NZ_CP028324.1 | Massilia armeniaca |
| 117 | 3812792 | 3813031 | - | NZ_CP019038.1 | Massilia putida |
| 118 | 1252309 | 1252542 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 119 | 188959 | 189189 | - | NZ_CP022423.1 | Vitreoscilla filiformis |
| 120 | 1662356 | 1662622 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 121 | 4007938 | 4008186 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 122 | 602977 | 603222 | - | NZ_CP046378.1 | Shewanella algae |
| 123 | 3577195 | 3577431 | - | NZ_CP046904.1 | Massilia flava |
| 124 | 1443521 | 1443745 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 125 | 3901618 | 3901848 | + | NZ_CP014646.1 | Thauera humireducens |
| 126 | 353050 | 353280 | + | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 127 | 492787 | 493026 | - | NC_016901.1 | Shewanella baltica OS678 |
| 128 | 3911625 | 3911849 | - | NZ_CP053069.1 | Usitatibacter rugosus |
| 129 | 3836976 | 3837209 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 130 | 908114 | 908341 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 131 | 667780 | 668040 | + | NZ_CP031124.1 | Ephemeroptericola cinctiostellae |
| 132 | 3291971 | 3292192 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 133 | 1415075 | 1415302 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 134 | 7176601 | 7176834 | + | NZ_CP036401.1 | Massilia albidiflava |
| 135 | 828439 | 828681 | + | NZ_CP035503.1 | Rhodoferax sediminis |
| 136 | 487883 | 488104 | + | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 137 | 545186 | 545425 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 138 | 4743367 | 4743600 | - | NZ_CP040017.1 | Massilia umbonata |
| 139 | 313619 | 313852 | + | NZ_CP029843.1 | Lysobacter maris |
| 140 | 3350288 | 3350527 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 141 | 123945 | 124181 | - | NZ_CP048832.1 | Janthinobacterium lividum |
| 142 | 1972426 | 1972644 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 143 | 4022997 | 4023233 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 144 | 131579 | 131815 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 145 | 103356 | 103568 | - | NZ_CP059563.1 | Conchiformibius steedae |
| 146 | 92488 | 92718 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 147 | 4045159 | 4045386 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 148 | 806944 | 807171 | + | NZ_LR134167.1 | Avibacterium volantium |
| 149 | 2894616 | 2894852 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 150 | 4074371 | 4074598 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 151 | 3529209 | 3529451 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 152 | 3798129 | 3798383 | - | NZ_CP012621.1 | Zobellella denitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054840.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01502.20 | 0.87 | 131 | 1226 | same-strand | Phosphoribosyl-AMP cyclohydrolase |
| 2 | PF01230.25 | 0.83 | 125 | 89 | same-strand | HIT domain |
| 3 | PF11969.10 | 0.83 | 125 | 89 | same-strand | Scavenger mRNA decapping enzyme C-term binding |
| 4 | PF00902.20 | 1.0 | 150 | 587.0 | same-strand | Sec-independent protein translocase protein (TatC) |
| 5 | PF13365.8 | 0.68 | 102 | 1553.5 | opposite-strand | Trypsin-like peptidase domain |
| 6 | PF00089.28 | 0.68 | 102 | 1553.5 | opposite-strand | Trypsin |
| 7 | PF13180.8 | 0.68 | 102 | 1553.5 | opposite-strand | PDZ domain |
| 8 | PF01503.19 | 0.86 | 129 | 827 | same-strand | Phosphoribosyl-ATP pyrophosphohydrolase |
| 9 | PF01784.20 | 0.65 | 97 | 2882 | same-strand | NIF3 (NGG1p interacting factor 3) |
| 10 | PF00977.23 | 0.71 | 107 | 1836 | same-strand | Histidine biosynthesis protein |
++ More..