Result : C4XIS1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AP010904.1 |
| Organism | Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) |
| Left | 3563589 |
| Right | 3563828 |
| Strand | - |
| Nucleotide Sequence | ATGCTCATCTTGACCCGGAGGCCGGGCGAAAGCCTGCACCTCGGAGACCATATCAAGATCACCGTCCTGGGAGTCCAGGGCAAGCAGATCAAGATCGGGCTGGAAGTGCCCGACGACATGCAGGTGTATCGCGAAGAGGTTTATCTGCGGGTGCTTGAACAGAATCGGCAGGCGCTTTGCGCCATGGATTCCGATGTCCTGGCGGCGGCGAAGTTATGGCCAAAAAAAACGAACGAATAG |
| Sequence | MLILTRRPGESLHLGDHIKITVLGVQGKQIKIGLEVPDDMQVYREEVYLRVLEQNRQALCAMDSDVLAAAKLWPKKTNE |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 19675025 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | C4XIS1 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1468219 | 1468458 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 2 | 3563589 | 3563828 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 3 | 2816827 | 2817066 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 4 | 4369543 | 4369782 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 5 | 3136122 | 3136358 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 6 | 1275674 | 1275904 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 7 | 63157 | 63399 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 8 | 4010854 | 4011093 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 9 | 736817 | 737059 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 10 | 2344015 | 2344257 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 11 | 600772 | 601008 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 12 | 3548510 | 3548752 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 13 | 2689341 | 2689580 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 14 | 872991 | 873227 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 15 | 3154265 | 3154504 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 16 | 1139150 | 1139389 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 17 | 2756857 | 2757096 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 18 | 1828929 | 1829168 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 19 | 3050107 | 3050304 | - | NZ_CP036422.1 | Halioglobus maricola |
| 20 | 3193307 | 3193501 | - | NZ_CP054301.1 | Marinomonas primoryensis |
| 21 | 1958775 | 1958972 | - | NZ_AP018933.1 | Zymobacter palmae |
| 22 | 148219 | 148437 | + | NZ_LR699011.1 | Roseburia hominis |
| 23 | 2425030 | 2425224 | - | NC_013861.1 | Legionella longbeachae NSW150 |
| 24 | 2055646 | 2055840 | - | NZ_CP025491.2 | Legionella sainthelensi |
| 25 | 397493 | 397687 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 26 | 883966 | 884163 | + | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 27 | 2688222 | 2688440 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP026538.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10135.11 | 0.62 | 16 | 4444.0 | same-strand | Rod binding protein |
| 2 | PF05130.14 | 0.65 | 17 | 3904.5 | same-strand | FlgN protein |
| 3 | PF00669.22 | 0.65 | 17 | 116 | same-strand | Bacterial flagellin N-terminal helical region |
| 4 | PF02623.17 | 0.69 | 18 | -21 | same-strand | FliW protein |
++ More..