Result : C4LIK7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP001620.1 |
| Organism | Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717) |
| Left | 1078907 |
| Right | 1079182 |
| Strand | - |
| Nucleotide Sequence | ATGGCTAACCTAGGGTTTCCAGAACTCGTTCTCATCGCAGTCGTCATACTCGTCCTCTTTGGATGGAAGAAACTTCCTGACGCTGCGCGTTCAGTTGGTCGTTCCATGCGCATCTTCAAATCTGAAGTCTCAGAAATGAAGAACGATGGCGCAGAGGCAGAGAAGACCTCGGCCGCATCGACCAAGACTGATGAGATCACCTCAGTATCGTCAACCGACACGCCTCAGCCAACGGTGACGGTGGAGTCCAAGGACGAAAAGAAGCATCCCGCCTAA |
| Sequence | MANLGFPELVLIAVVILVLFGWKKLPDAARSVGRSMRIFKSEVSEMKNDGAEAEKTSAASTKTDEITSVSSTDTPQPTVTVESKDEKKHPA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 18430482 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | C4LIK7 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1078907 | 1079182 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 2 | 1093010 | 1093258 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
| 3 | 1575860 | 1576114 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 4 | 3572562 | 3572822 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 5 | 2338240 | 2338482 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011312.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00557.26 | 0.8 | 4 | 5023.5 | same-strand | Metallopeptidase family M24 |
| 2 | PF08148.14 | 1.0 | 5 | 996 | same-strand | DSHCT (NUC185) domain |
| 3 | PF00270.31 | 1.0 | 5 | 996 | same-strand | DEAD/DEAH box helicase |
| 4 | PF04851.17 | 1.0 | 5 | 996 | same-strand | Type III restriction enzyme, res subunit |
| 5 | PF00902.20 | 1.0 | 5 | 44 | same-strand | Sec-independent protein translocase protein (TatC) |
| 6 | PF13280.8 | 1.0 | 5 | 85 | same-strand | WYL domain |
| 7 | PF19187.2 | 1.0 | 5 | 75 | same-strand | PafC helix-turn-helix domain |
| 8 | PF03136.17 | 1.0 | 5 | 2493.0 | same-strand | Pup-ligase protein |
| 9 | PF01321.20 | 0.6 | 3 | 5589 | same-strand | Creatinase/Prolidase N-terminal domain |
++ More..