Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CP001620.1 |
Organism | Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717) |
Left | 1078907 |
Right | 1079182 |
Strand | - |
Nucleotide Sequence | ATGGCTAACCTAGGGTTTCCAGAACTCGTTCTCATCGCAGTCGTCATACTCGTCCTCTTTGGATGGAAGAAACTTCCTGACGCTGCGCGTTCAGTTGGTCGTTCCATGCGCATCTTCAAATCTGAAGTCTCAGAAATGAAGAACGATGGCGCAGAGGCAGAGAAGACCTCGGCCGCATCGACCAAGACTGATGAGATCACCTCAGTATCGTCAACCGACACGCCTCAGCCAACGGTGACGGTGGAGTCCAAGGACGAAAAGAAGCATCCCGCCTAA |
Sequence | MANLGFPELVLIAVVILVLFGWKKLPDAARSVGRSMRIFKSEVSEMKNDGAEAEKTSAASTKTDEITSVSSTDTPQPTVTVESKDEKKHPA |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 18430482 |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | C4LIK7 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1078907 | 1079182 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
2 | 1093010 | 1093258 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
3 | 1575860 | 1576114 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
4 | 3572562 | 3572822 | + | NZ_CP059694.1 | Gordonia rubripertincta |
5 | 2338240 | 2338482 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00557.26 | 0.8 | 4 | 5023.5 | same-strand | Metallopeptidase family M24 |
2 | PF08148.14 | 1.0 | 5 | 996 | same-strand | DSHCT (NUC185) domain |
3 | PF00270.31 | 1.0 | 5 | 996 | same-strand | DEAD/DEAH box helicase |
4 | PF04851.17 | 1.0 | 5 | 996 | same-strand | Type III restriction enzyme, res subunit |
5 | PF00902.20 | 1.0 | 5 | 44 | same-strand | Sec-independent protein translocase protein (TatC) |
6 | PF13280.8 | 1.0 | 5 | 85 | same-strand | WYL domain |
7 | PF19187.2 | 1.0 | 5 | 75 | same-strand | PafC helix-turn-helix domain |
8 | PF03136.17 | 1.0 | 5 | 2493.0 | same-strand | Pup-ligase protein |
9 | PF01321.20 | 0.6 | 3 | 5589 | same-strand | Creatinase/Prolidase N-terminal domain |