Result : C4LG87
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein ckrop_0143 |
| NCBI Accession ID | CP001620.1 |
| Organism | Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717) |
| Left | 187530 |
| Right | 187832 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGAGCCCGACTTCAACGAAATCATGGCCCAAGCACAGCAAATGCAGGAAGAACTGCAGCGCGTGCAAGGTGAAATCGCGCAATCCGAAATCAGCGGCAGCGCAGGCAACGGCCTGGTCAAGGTCACCATGAAGGGTACCGGCGAGGTCACCAACGTCACCATCGACAAGTCCGTCGTCGACCCCGATGATGTCGACACTCTCCAAGACCTCGTCCTCGGAGCGCTCCAGGACGCCAACACCGCGTTACAGTCGTACGCGCAGGAAAAGATGGGCCCGTTCTCGCAGGCACTCGGCTAA |
| Sequence | MAEPDFNEIMAQAQQMQEELQRVQGEIAQSEISGSAGNGLVKVTMKGTGEVTNVTIDKSVVDPDDVDTLQDLVLGALQDANTALQSYAQEKMGPFSQALG |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | 18430482 |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | C4LG87 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 93
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 187530 | 187832 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 2 | 197547 | 197873 | + | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 3 | 185348 | 185692 | + | NC_012590.1 | Corynebacterium aurimucosum ATCC 700975 |
| 4 | 257018 | 257329 | + | NZ_CP009246.1 | Corynebacterium flavescens |
| 5 | 1544881 | 1545198 | - | NZ_LT906481.1 | Corynebacterium urealyticum |
| 6 | 164850 | 165140 | + | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 7 | 185146 | 185490 | + | NZ_CP010827.1 | Corynebacterium singulare |
| 8 | 215026 | 215370 | + | NZ_CP009249.1 | Corynebacterium phocae |
| 9 | 2534219 | 2534563 | - | NZ_LS483460.1 | Corynebacterium minutissimum |
| 10 | 153986 | 154294 | + | NZ_CP011311.1 | Corynebacterium camporealensis |
| 11 | 322226 | 322561 | + | NC_020302.1 | Corynebacterium halotolerans YIM 70093 = DSM 44683 |
| 12 | 133867 | 134202 | + | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 13 | 165278 | 165601 | + | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
| 14 | 1357892 | 1358206 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 15 | 2455426 | 2455728 | - | NZ_CP067012.1 | Corynebacterium kefirresidentii |
| 16 | 261156 | 261428 | + | NZ_LR698967.1 | Corynebacterium ammoniagenes |
| 17 | 281020 | 281304 | + | NZ_CP009251.1 | Corynebacterium stationis |
| 18 | 170099 | 170419 | + | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 19 | 239974 | 240294 | + | NZ_LR738855.1 | Corynebacterium rouxii |
| 20 | 166822 | 167133 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 21 | 4276109 | 4276408 | + | NZ_CP033972.1 | Gordonia insulae |
| 22 | 989809 | 990147 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 23 | 268917 | 269201 | + | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 24 | 290428 | 290709 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 25 | 1273396 | 1273668 | - | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 26 | 1029784 | 1030068 | + | NZ_LS483464.1 | Corynebacterium renale |
| 27 | 1898944 | 1899267 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 28 | 2102554 | 2102868 | - | NZ_CP046883.1 | Corynebacterium anserum |
| 29 | 196637 | 196960 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 30 | 2413897 | 2414217 | - | NZ_LT906473.1 | Corynebacterium cystitidis |
| 31 | 88032 | 88358 | + | NC_022198.1 | Corynebacterium argentoratense DSM 44202 |
| 32 | 1878712 | 1879047 | - | NZ_CP032788.1 | Corynebacterium xerosis |
| 33 | 384803 | 385117 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 34 | 390169 | 390480 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 35 | 2471780 | 2472094 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 36 | 140438 | 140710 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 37 | 2445728 | 2446042 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 38 | 248568 | 248864 | + | NZ_CP034550.1 | Saccharothrix syringae |
| 39 | 289880 | 290203 | + | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 40 | 397033 | 397287 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 41 | 1751799 | 1752068 | - | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 42 | 2313075 | 2313356 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 43 | 524632 | 524901 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 44 | 273475 | 273786 | + | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 45 | 264027 | 264338 | + | NZ_CP015622.1 | Corynebacterium crudilactis |
| 46 | 2220531 | 2220851 | - | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 47 | 2241124 | 2241444 | - | NZ_CP035299.1 | Corynebacterium pelargi |
| 48 | 224717 | 225040 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 49 | 235684 | 235995 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 50 | 6694395 | 6694667 | - | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 51 | 1912518 | 1912847 | - | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 52 | 4137327 | 4137572 | - | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 53 | 4523145 | 4523408 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 54 | 3352077 | 3352355 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 55 | 2144978 | 2145298 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 56 | 7334981 | 7335259 | - | NZ_AP022870.1 | Phytohabitans flavus |
| 57 | 806011 | 806274 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 58 | 1756173 | 1756439 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 59 | 523862 | 524149 | + | NZ_CP015449.1 | Dietzia lutea |
| 60 | 451594 | 451881 | + | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 61 | 232979 | 233305 | + | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 62 | 1371440 | 1371709 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 63 | 152141 | 152461 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 64 | 2375027 | 2375293 | + | NZ_AP022562.1 | Mycobacterium novum |
| 65 | 4254121 | 4254387 | - | NC_015576.1 | Mycolicibacter sinensis |
| 66 | 4178779 | 4179060 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 67 | 2608817 | 2609092 | - | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 68 | 236084 | 236356 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 69 | 854641 | 854904 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 70 | 2774605 | 2774940 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 71 | 1683145 | 1683465 | + | NZ_LT906443.1 | Corynebacterium ulcerans |
| 72 | 203430 | 203753 | + | NZ_CP011545.1 | Corynebacterium testudinoris |
| 73 | 308319 | 308582 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 74 | 150103 | 150423 | + | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 75 | 1179922 | 1180185 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 76 | 273043 | 273363 | + | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 77 | 509168 | 509503 | + | NZ_CP015961.1 | Dietzia timorensis |
| 78 | 141074 | 141343 | + | NZ_CP011546.1 | Corynebacterium uterequi |
| 79 | 2445150 | 2445419 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 80 | 242302 | 242586 | + | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 81 | 3182138 | 3182401 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 82 | 1957053 | 1957316 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 83 | 1218037 | 1218339 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 84 | 6351786 | 6352049 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 85 | 4634513 | 4634803 | - | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 86 | 915110 | 915358 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 87 | 140419 | 140682 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 88 | 754534 | 754797 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 89 | 4115269 | 4115532 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 90 | 5523746 | 5524009 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 91 | 5805265 | 5805528 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 92 | 512335 | 512598 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 93 | 425067 | 425351 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007790.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13662.8 | 0.95 | 88 | 40.0 | same-strand | Toprim domain |
| 2 | PF02132.17 | 0.99 | 92 | 40.0 | same-strand | RecR protein |
| 3 | PF01751.24 | 0.96 | 89 | 38 | same-strand | Toprim domain |
| 4 | PF13177.8 | 0.84 | 78 | 112.5 | same-strand | DNA polymerase III, delta subunit |
| 5 | PF12169.10 | 0.84 | 78 | 112.5 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 6 | PF00004.31 | 0.84 | 78 | 112.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF13401.8 | 0.73 | 68 | 118.5 | same-strand | AAA domain |
| 8 | PF07685.16 | 0.61 | 57 | 1625 | opposite-strand | CobB/CobQ-like glutamine amidotransferase domain |
++ More..