Result : C4LA34
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CP001616.1 |
| Organism | Tolumonas auensis (strain DSM 9187 / TA4) |
| Left | 603189 |
| Right | 603407 |
| Strand | - |
| Nucleotide Sequence | ATGAGCCTGAAAGTTGATTGTCCGACCTGCGGAACCCCGGTCGAGTGGAGCCCGCTTAGCCAGTTTCGCCCTTTTTGCAGCGACCGCTGCCGTTTGATCGACCTCGGCGAATGGTTCAGCGAAGAACGCAGTATCGCCGGTGAAGAACACACCCCATCATCAGATACCGCCAGACCACAACTCTCAGCAGAAGATCTGGCATTACTGGAGCAGGATTAA |
| Sequence | MSLKVDCPTCGTPVEWSPLSQFRPFCSDRCRLIDLGEWFSEERSIAGEEHTPSSDTARPQLSAEDLALLEQD |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | C4LA34 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 603189 | 603407 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 2 | 5770617 | 5770823 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 3 | 5187952 | 5188158 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 4 | 2587058 | 2587264 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 5 | 5710041 | 5710247 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 6 | 767040 | 767240 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 7 | 855095 | 855286 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 8 | 116166 | 116357 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 9 | 3865108 | 3865317 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 10 | 1451692 | 1451883 | - | NZ_CP049044.1 | Pseudomonas psychrophila |
| 11 | 999506 | 999727 | + | NZ_CP041660.1 | Catenovulum sediminis |
| 12 | 4417794 | 4417985 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 13 | 4875833 | 4876033 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 14 | 2214651 | 2214842 | - | NC_017856.1 | Methylophaga frappieri |
| 15 | 871200 | 871430 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 16 | 394071 | 394295 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 17 | 871372 | 871560 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 18 | 874280 | 874468 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 19 | 1092525 | 1092713 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 20 | 892868 | 893056 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 21 | 3016962 | 3017174 | + | NZ_LR134374.1 | Legionella spiritensis |
| 22 | 707343 | 707528 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 23 | 1014529 | 1014717 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 24 | 2786177 | 2786374 | + | NZ_CP049134.1 | Paraburkholderia tropica |
| 25 | 949977 | 950165 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 26 | 314401 | 314601 | - | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 27 | 5880699 | 5880902 | + | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 28 | 675255 | 675443 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
| 29 | 2630569 | 2630766 | + | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 30 | 2607388 | 2607615 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 31 | 5136526 | 5136708 | - | NZ_CP019038.1 | Massilia putida |
| 32 | 904366 | 904563 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 33 | 439009 | 439209 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 34 | 2205908 | 2206126 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 35 | 332410 | 332628 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 36 | 1039602 | 1039799 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 37 | 1413707 | 1413904 | - | NZ_CP048796.1 | Providencia vermicola |
| 38 | 1431999 | 1432202 | - | NZ_LS483422.1 | Providencia heimbachae |
| 39 | 2014084 | 2014299 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012691.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01121.22 | 0.97 | 38 | 9.0 | same-strand | Dephospho-CoA kinase |
| 2 | PF06750.15 | 0.85 | 33 | 632 | same-strand | Bacterial Peptidase A24 N-terminal domain |
| 3 | PF01478.20 | 0.92 | 36 | 634.0 | same-strand | Type IV leader peptidase family |
| 4 | PF00482.25 | 0.95 | 37 | 1502 | same-strand | Type II secretion system (T2SS), protein F |
| 5 | PF00437.22 | 0.62 | 24 | 2729.0 | same-strand | Type II/IV secretion system protein |
| 6 | PF07963.14 | 0.67 | 26 | 3990.0 | opposite-strand | Prokaryotic N-terminal methylation motif |
++ More..