Result : C4L5X2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001615.1 |
| Organism | Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) |
| Left | 2829098 |
| Right | 2829307 |
| Strand | + |
| Nucleotide Sequence | ATGTTATACCCTTCGATTGATGCCTTACAACGTACTATCCCGTCAAAATACACGATCGTTACGGTCGCTGCGAAACGGGCGCGTCAGATTCAAGATGGAAAAGCACCGAAAGTCGCCGAGCCAAAATCATATAAGCCGGTCGGTCAAGCGTTAGAAGAACTATTTTCGGGTGATACGACAATCATCGTGAACGAAAAAAACAACGGATGA |
| Sequence | MLYPSIDALQRTIPSKYTIVTVAAKRARQIQDGKAPKVAEPKSYKPVGQALEELFSGDTTIIVNEKNNG |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | C4L5X2 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 75
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1638749 | 1638958 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 2 | 1888412 | 1888615 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 3 | 1590837 | 1591049 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 4 | 2185099 | 2185299 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 5 | 1293683 | 1293889 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 6 | 1188301 | 1188501 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 7 | 274179 | 274379 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 8 | 2794404 | 2794604 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 9 | 636150 | 636350 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 10 | 3310167 | 3310361 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 11 | 1953821 | 1954024 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 12 | 2404825 | 2405025 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 13 | 2124672 | 2124884 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 14 | 1770415 | 1770615 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 586483 | 586683 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 16 | 1661282 | 1661494 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 17 | 1748378 | 1748578 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 18 | 1401133 | 1401336 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 19 | 1770980 | 1771180 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 20 | 1626647 | 1626853 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 21 | 1533045 | 1533248 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 22 | 2117209 | 2117427 | + | NZ_CP053989.1 | Niallia circulans |
| 23 | 1394823 | 1395017 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 24 | 1545775 | 1545966 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 25 | 1773722 | 1773922 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 26 | 2819743 | 2819940 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 2075105 | 2075329 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 28 | 1667937 | 1668134 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 29 | 3426240 | 3426440 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 30 | 1763893 | 1764087 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 31 | 410165 | 410362 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 32 | 1016176 | 1016376 | + | NZ_LR134483.1 | Listeria grayi |
| 33 | 154653 | 154856 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 34 | 339096 | 339299 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 35 | 2276019 | 2276225 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 36 | 1193915 | 1194130 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 37 | 1746233 | 1746445 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 38 | 1010059 | 1010268 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 39 | 4869185 | 4869400 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 40 | 3536425 | 3536622 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 41 | 969563 | 969772 | + | NZ_CP047361.1 | Macrococcus canis |
| 42 | 2699972 | 2700178 | - | NZ_LS483476.1 | Lederbergia lentus |
| 43 | 3940617 | 3940829 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 44 | 2481307 | 2481513 | + | NZ_CP026363.1 | Brevibacillus agri |
| 45 | 1544613 | 1544816 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 46 | 3774362 | 3774565 | - | NZ_CP043404.1 | Bacillus safensis |
| 47 | 107318 | 107524 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 48 | 991263 | 991469 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 49 | 3366278 | 3366487 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 50 | 536969 | 537172 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 51 | 4189187 | 4189393 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 52 | 1516196 | 1516423 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 53 | 1485391 | 1485600 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 54 | 1581718 | 1581930 | - | NZ_CP014164.1 | Aerococcus viridans |
| 55 | 985923 | 986123 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 56 | 624987 | 625199 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 57 | 4044498 | 4044704 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 58 | 970752 | 970952 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 59 | 2654854 | 2655054 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 60 | 2363652 | 2363855 | - | NZ_CP011937.1 | Bacillus velezensis |
| 61 | 1597291 | 1597494 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 62 | 1640371 | 1640565 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 63 | 1003864 | 1004058 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 64 | 746646 | 746855 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 65 | 1820926 | 1821129 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 66 | 1549964 | 1550167 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 67 | 1646645 | 1646848 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 68 | 1609107 | 1609310 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 69 | 1615437 | 1615640 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 70 | 343373 | 343576 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 71 | 1642567 | 1642770 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 72 | 2001466 | 2001690 | - | NZ_CP016538.2 | Planococcus maritimus |
| 73 | 2024709 | 2024933 | - | NZ_CP059540.1 | Planococcus maritimus |
| 74 | 1005599 | 1005805 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 75 | 179681 | 179905 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 76 | 1790295 | 1790501 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014342.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01189.19 | 0.87 | 65 | 5165.5 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 2 | PF01029.20 | 0.87 | 65 | 5165.5 | same-strand | NusB family |
| 3 | PF01327.23 | 0.65 | 49 | 3743.0 | same-strand | Polypeptide deformylase |
| 4 | PF00551.21 | 0.92 | 69 | 4228.5 | same-strand | Formyl transferase |
| 5 | PF02911.20 | 0.92 | 69 | 4228.5 | same-strand | Formyl transferase, C-terminal domain |
| 6 | PF17764.3 | 0.96 | 72 | 1311 | same-strand | 3'DNA-binding domain (3'BD) |
| 7 | PF00270.31 | 0.96 | 72 | 1311 | same-strand | DEAD/DEAH box helicase |
| 8 | PF18074.3 | 0.96 | 72 | 1311 | same-strand | Primosomal protein N C-terminal domain |
| 9 | PF04851.17 | 0.96 | 72 | 1311 | same-strand | Type III restriction enzyme, res subunit |
| 10 | PF18319.3 | 0.96 | 72 | 1311 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 11 | PF04127.17 | 0.92 | 69 | 87.0 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 12 | PF02441.21 | 0.92 | 69 | 87.0 | same-strand | Flavoprotein |
| 13 | PF00625.23 | 0.99 | 74 | 3.0 | same-strand | Guanylate kinase |
| 14 | PF05833.13 | 0.76 | 57 | 4717.5 | opposite-strand | NFACT N-terminal and middle domains |
| 15 | PF05670.15 | 0.76 | 57 | 4717.5 | opposite-strand | NFACT protein RNA binding domain |
| 16 | PF04025.14 | 0.8 | 60 | 632 | same-strand | Domain of unknown function (DUF370) |
| 17 | PF03755.15 | 0.75 | 56 | 952.0 | same-strand | YicC-like family, N-terminal region |
| 18 | PF08340.13 | 0.75 | 56 | 952.0 | same-strand | Domain of unknown function (DUF1732) |
| 19 | PF00122.22 | 0.65 | 49 | 1930.0 | same-strand | E1-E2 ATPase |
| 20 | PF00689.23 | 0.64 | 48 | 1930.0 | same-strand | Cation transporting ATPase, C-terminus |
| 21 | PF00702.28 | 0.63 | 47 | 1930.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 22 | PF00690.28 | 0.65 | 49 | 1930 | same-strand | Cation transporter/ATPase, N-terminus |
| 23 | PF13246.8 | 0.65 | 49 | 1930 | same-strand | Cation transport ATPase (P-type) |
++ More..