Result : C4K473
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001277.1 |
| Organism | Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) |
| Left | 619302 |
| Right | 619574 |
| Strand | + |
| Nucleotide Sequence | ATGGCACGTGTCACAGTTCAAGCAGCAGTAGAAAAAGTGGGTAATCGCTTTAAGTTAATTTTAGTGGCAGTACATCGAGCTCGTCTGCTGCAATCGGGACGTGAAAATTCATTGGTTCCTGAAGAAAACGATAAAGTCACTGTCATTGCCCTTCGTGAGATTGAGCAGGGTCTAATTACAGAAAGTATTCTAAAAGAAAATAATCAGCACGAAGATCAGATACAAAAAAAAGTACAAATGAAAACCATTTCTTCAACTCAAGACTTTGATTAA |
| Sequence | MARVTVQAAVEKVGNRFKLILVAVHRARLLQSGRENSLVPEENDKVTVIALREIEQGLITESILKENNQHEDQIQKKVQMKTISSTQDFD |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 19451630 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | C4K473 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 57
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 285036 | 285308 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 2 | 3523711 | 3523986 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 3 | 241846 | 242118 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 4 | 3230977 | 3231249 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 5 | 235788 | 236063 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 6 | 4126263 | 4126538 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 7 | 251679 | 251951 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 8 | 192752 | 193027 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 9 | 471793 | 472068 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 10 | 4467580 | 4467855 | - | NZ_CP015581.1 | Tatumella citrea |
| 11 | 143739 | 144014 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 12 | 491688 | 491963 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 13 | 65958 | 66233 | - | NZ_LS483470.1 | Leminorella richardii |
| 14 | 60300 | 60575 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 15 | 65797 | 66072 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 16 | 123657 | 123929 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 17 | 75180 | 75455 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 18 | 3930093 | 3930368 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 19 | 178442 | 178717 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 20 | 211512 | 211787 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 21 | 242454 | 242729 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 22 | 98807 | 99082 | - | NZ_LR134531.1 | Pragia fontium |
| 23 | 522819 | 523100 | + | NZ_CP022355.1 | Paraphotobacterium marinum |
| 24 | 3792421 | 3792696 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 25 | 1689923 | 1690198 | - | NZ_CP019706.1 | Pantoea alhagi |
| 26 | 107780 | 108061 | - | NZ_CP046531.1 | Mannheimia ovis |
| 27 | 107901 | 108182 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 28 | 320380 | 320661 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 29 | 230136 | 230417 | - | NZ_CP061280.1 | Mannheimia bovis |
| 30 | 406171 | 406452 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 31 | 1857371 | 1857643 | - | NZ_CP018804.1 | Histophilus somni |
| 32 | 1771193 | 1771462 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 33 | 1340604 | 1340870 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 34 | 1728249 | 1728515 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 35 | 2239279 | 2239545 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 36 | 2088705 | 2088980 | - | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 37 | 355898 | 356179 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 38 | 929008 | 929274 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 39 | 188621 | 188890 | - | NZ_CP028926.1 | Pasteurella multocida |
| 40 | 2090914 | 2091195 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 41 | 1875428 | 1875709 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 42 | 1862165 | 1862446 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 43 | 2114881 | 2115147 | - | NZ_LR134167.1 | Avibacterium volantium |
| 44 | 144379 | 144654 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 45 | 1031210 | 1031491 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 46 | 157303 | 157584 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 47 | 3322886 | 3323161 | + | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 48 | 1171666 | 1171935 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 49 | 668152 | 668427 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 50 | 2584209 | 2584484 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 51 | 1951459 | 1951734 | + | NZ_CP041660.1 | Catenovulum sediminis |
| 52 | 2154890 | 2155174 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 53 | 150522 | 150794 | + | NZ_CP008849.1 | Alteromonas australica |
| 54 | 195728 | 196012 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 55 | 2553700 | 2553969 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 56 | 171598 | 171846 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 57 | 649253 | 649534 | + | NZ_CP060092.1 | Teredinibacter purpureus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016176.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13328.8 | 1.0 | 57 | 45 | same-strand | HD domain |
| 2 | PF04607.19 | 1.0 | 57 | 45 | same-strand | Region found in RelA / SpoT proteins |
| 3 | PF02824.23 | 1.0 | 57 | 45 | same-strand | TGS domain |
| 4 | PF13291.8 | 0.98 | 56 | 46.0 | same-strand | ACT domain |
| 5 | PF01966.24 | 1.0 | 57 | 45 | same-strand | HD domain |
| 6 | PF00625.23 | 0.77 | 44 | 58.0 | same-strand | Guanylate kinase |
| 7 | PF00271.33 | 0.65 | 37 | 2845.0 | same-strand | Helicase conserved C-terminal domain |
| 8 | PF17191.6 | 0.65 | 37 | 2844 | same-strand | RecG wedge domain |
| 9 | PF04851.17 | 0.67 | 38 | 2844 | same-strand | Type III restriction enzyme, res subunit |
| 10 | PF01336.27 | 0.63 | 36 | 2846 | same-strand | OB-fold nucleic acid binding domain |
++ More..