Protein name |
Cell division protein ZapB |
NCBI Accession ID |
CP001277.1 |
Organism |
Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) |
Left |
554399 |
Right |
554638 |
Strand |
- |
Nucleotide Sequence |
ATGTCATTGGAAGCTTTGGACCAATTGCAAGAAAAAGTTCAGAAAATGCTTGAAGCAAATGCCTTGTTACAAATGGAAATAGAAGAATTTAAAGAAAAGAATATTGTCTTAGAAGAAAAAATAAATGCTATTTCAGCTCAACAAAAAGATTTAGTAGATCAAAATAATGAGCTAAAACAAGAAAAAACCGTTTGGCAAAATCGTTTGAATTCGCTTTTAGGTAAGATGGATGATATTTAA |
Sequence |
MSLEALDQLQEKVQKMLEANALLQMEIEEFKEKNIVLEEKINAISAQQKDLVDQNNELKQEKTVWQNRLNSLLGKMDDI |
Source of smORF |
Swiss-Prot |
Function |
Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA. {ECO:0000255|HAMAP-Rule:MF_01196}. |
Pubmed ID |
19451630
|
Domain |
CDD:416309 |
Functional Category |
Others |
Uniprot ID |
C4K415
|
ORF Length (Amino Acid) |
79 |