Result : C4K1G9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP001227.1 |
| Organism | Rickettsia peacockii (strain Rustic) |
| Left | 547678 |
| Right | 547845 |
| Strand | + |
| Nucleotide Sequence | ATGGGAATGAGCTTTAGCCATTTATTAATAGTTTTATTAATTATTTTTGTATTATTCGGTGCCGGCAAATTACCGCAAGTCATGTCCGATCTTGCTAAAGGTCTTAAAGCTTTTAAAGACGGCATGAAAGACGACGGTAGTGATAATGATAATGATAAAAATAAATAA |
| Sequence | MGMSFSHLLIVLLIIFVLFGAGKLPQVMSDLAKGLKAFKDGMKDDGSDNDNDKNK |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 20027221 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | C4K1G9 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1066231 | 1066392 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 2 | 1072854 | 1073015 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 3 | 1077394 | 1077555 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 4 | 393931 | 394092 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 5 | 1109874 | 1110035 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 6 | 964765 | 964929 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 7 | 1064977 | 1065138 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 8 | 1015813 | 1015974 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 9 | 935568 | 935732 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 10 | 522899 | 523060 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 11 | 935830 | 935991 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 12 | 1506316 | 1506471 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 13 | 48079 | 48252 | + | NZ_CP029356.1 | Azospirillum thermophilum |
| 14 | 2705345 | 2705485 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010263.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00590.22 | 0.86 | 12 | 1305.5 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 2 | PF04608.15 | 0.86 | 12 | 78.5 | opposite-strand | Phosphatidylglycerophosphatase A |
| 3 | PF00829.23 | 0.86 | 12 | 769.0 | opposite-strand | Ribosomal prokaryotic L21 protein |
| 4 | PF01016.21 | 0.86 | 12 | 1111.0 | opposite-strand | Ribosomal L27 protein |
| 5 | PF00696.30 | 0.79 | 11 | 1656 | opposite-strand | Amino acid kinase family |
| 6 | PF13840.8 | 0.79 | 11 | 1656 | opposite-strand | ACT domain |
++ More..