Result : C3P4I5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
| NCBI Accession ID | CP001598.1 |
| Organism | Bacillus anthracis (strain A0248) |
| Left | 1319818 |
| Right | 1320057 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGAATTTAAAGAGCAAGTATTAGATATTTTAGAAGAAGTATGTGAAAACGATATTGTAAAAGAAAACTTAGATGTTCAATTATTTGAAGAAGGTATTCTTGATTCTTTCGCTGTAGTATCTTTATTAGTTGAATTCCAAGAGCGTTTAGATATTGAAGTTTCTATTTCTGATTTTGATCGTGACGAGTGGGCTACTCCAAACATGGTTATTAAGAAGTTGGAAGAAATCCGATGA |
| Sequence | MAEFKEQVLDILEEVCENDIVKENLDVQLFEEGILDSFAVVSLLVEFQERLDIEVSISDFDRDEWATPNMVIKKLEEIR |
| Source of smORF | Swiss-Prot |
| Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
| Pubmed ID | |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | C3P4I5 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 70
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3765350 | 3765589 | + | NZ_CP040336.1 | Bacillus luti |
| 2 | 1319918 | 1320157 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 1319642 | 1319881 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 1370812 | 1371051 | - | NC_011725.1 | Bacillus cereus B4264 |
| 5 | 1337727 | 1337966 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 6 | 1193205 | 1193444 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 406701 | 406940 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 859997 | 860233 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 9 | 1423640 | 1423876 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 10 | 1882294 | 1882530 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 11 | 194925 | 195161 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 12 | 2096825 | 2097061 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 13 | 2069259 | 2069495 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 14 | 1960976 | 1961212 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 15 | 906177 | 906413 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 16 | 836961 | 837197 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 17 | 606428 | 606625 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 18 | 954563 | 954799 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 19 | 2007058 | 2007294 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 20 | 856712 | 856927 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 21 | 2157882 | 2158118 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 726789 | 727025 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 23 | 1903809 | 1904015 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 24 | 1913702 | 1913938 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 25 | 1222182 | 1222388 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 26 | 341864 | 342100 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 27 | 1018881 | 1019117 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 28 | 1820783 | 1821019 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 29 | 1910242 | 1910439 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 30 | 1971646 | 1971882 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 31 | 4366881 | 4367099 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 32 | 245034 | 245270 | - | NZ_CP011937.1 | Bacillus velezensis |
| 33 | 3795093 | 3795329 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 34 | 3906641 | 3906877 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 35 | 4111620 | 4111856 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 36 | 1757900 | 1758136 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 37 | 921316 | 921534 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 38 | 2437340 | 2437576 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 39 | 3782436 | 3782672 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 40 | 3837390 | 3837626 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 41 | 2281551 | 2281787 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 42 | 1003593 | 1003829 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 43 | 3777420 | 3777656 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 44 | 3769967 | 3770203 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 45 | 3842921 | 3843157 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 46 | 3954987 | 3955223 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 47 | 753656 | 753892 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 48 | 513489 | 513725 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 49 | 26923 | 27159 | - | NZ_CP053989.1 | Niallia circulans |
| 50 | 1986728 | 1986964 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 51 | 526747 | 526983 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 52 | 2526133 | 2526369 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 53 | 872923 | 873144 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 54 | 1960411 | 1960647 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 55 | 3313329 | 3313562 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 56 | 948843 | 949046 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 57 | 2870908 | 2871144 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 58 | 2783199 | 2783435 | + | NZ_CP043404.1 | Bacillus safensis |
| 59 | 2521390 | 2521626 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 60 | 2341374 | 2341589 | - | NZ_LR134483.1 | Listeria grayi |
| 61 | 624918 | 625151 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 62 | 1550880 | 1551116 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 63 | 1987976 | 1988209 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 64 | 2045677 | 2045910 | - | NZ_CP065211.1 | Enterococcus lactis |
| 65 | 978362 | 978598 | - | NZ_LT906444.1 | Listeria welshimeri |
| 66 | 1020481 | 1020717 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 67 | 244439 | 244651 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 68 | 874492 | 874719 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 69 | 1187045 | 1187257 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 70 | 1205266 | 1205472 | + | NZ_CP046037.1 | Latilactobacillus sakei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12459.10 | 0.87 | 61 | 2723 | same-strand | D-Ala-teichoic acid biosynthesis protein |
| 2 | PF00501.30 | 1.0 | 70 | 1229.0 | same-strand | AMP-binding enzyme |
| 3 | PF13193.8 | 1.0 | 70 | 1229.0 | same-strand | AMP-binding enzyme C-terminal domain |
| 4 | PF04914.14 | 0.99 | 69 | -3 | same-strand | DltD protein |
++ More..