| Protein name |
UPF0751 protein BAMEG_A0107 |
| NCBI Accession ID |
|
| Organism |
Bacillus anthracis (strain CDC 684 / NRRL 3495) |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
|
| Sequence |
MSTILVLGGSNGRTLEKLAKKRDCQVIFHDGKNHGGVKKTFRSVIKKCDVIVIQKGACGHVSIDVAKEYAKKYDVPLLFNQGFGGTGALEMGLKHLKAA |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl01811. Profile Description: Uncharacterized protein conserved in bacteria (DUF2325). Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID |
|
| Domain |
CDD:413075 |
| Functional Category |
Others |
| Uniprot ID |
C3LL81
|
| ORF Length (Amino Acid) |
99 |