Result : C1P620
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YshB |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 4053647 |
| Right | 4053757 |
| Strand | - |
| Nucleotide Sequence | ATGCTGGAATCAATAATTAATCTGGTATCGAGTGGCGCAGTTGACAGCCACACACCGCAAACTGCCGTTGCTGCCGTGCTGTGTGCCGCAATGATTGGGCTGTTTAGCTGA |
| Sequence | MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of NF033841. Profile Description: YshB family small membrane protein. YshB, a membrane-associated protein typically 36 to 40 amino acids in length, is found conserved in genera of the gamma-proteobacteria including Cronobacter, Enterobacter, Escherichia, Klebiella, Salmonella, and Serratia. The gene symbol derives from E. coli K-12. |
| Pubmed ID | 9278503 16738553 19121005 |
| Domain | CDD:411410 |
| Functional Category | Others |
| Uniprot ID | C1P620 |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4849685 | 4849795 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4024031 | 4024141 | - | NZ_AP014857.1 | Escherichia albertii |
| 3 | 4053647 | 4053757 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4066335 | 4066445 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 2997690 | 2997800 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 4387122 | 4387232 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 4281667 | 4281777 | + | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 5044880 | 5044990 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 9 | 6123532 | 6123642 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 10 | 6111368 | 6111478 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 11 | 4686868 | 4686978 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 12 | 4619432 | 4619542 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 13 | 5352862 | 5352984 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 14 | 32044 | 32166 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 15 | 5377314 | 5377436 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 16 | 3184095 | 3184217 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 17 | 3111370 | 3111492 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 18 | 4212647 | 4212757 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 19 | 2914948 | 2915058 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 20 | 620903 | 621013 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 21 | 1053525 | 1053635 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 22 | 4107128 | 4107238 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 23 | 2264346 | 2264456 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 24 | 3278511 | 3278621 | + | NZ_CP038469.1 | Citrobacter tructae |
| 25 | 2825982 | 2826092 | - | NZ_CP033744.1 | Citrobacter freundii |
| 26 | 2014334 | 2014444 | - | NZ_CP053416.1 | Salmonella bongori |
| 27 | 3694880 | 3695002 | + | NZ_CP028271.1 | Mixta intestinalis |
| 28 | 2512118 | 2512228 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 29 | 4185373 | 4185495 | + | NZ_CP061511.1 | Mixta calida |
| 30 | 4490992 | 4491114 | + | NZ_CP026377.1 | Mixta gaviniae |
| 31 | 1767109 | 1767231 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 32 | 3173146 | 3173256 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 33 | 4649642 | 4649752 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 34 | 4593449 | 4593571 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 35 | 3454712 | 3454834 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 36 | 822330 | 822440 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 37 | 2643936 | 2644046 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 38 | 4667797 | 4667907 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 39 | 4569264 | 4569374 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 40 | 1049945 | 1050067 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 41 | 4734455 | 4734565 | + | NC_015968.1 | Enterobacter soli |
| 42 | 4805892 | 4806014 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 43 | 3759421 | 3759543 | + | NZ_CP065534.1 | Lonsdalea populi |
| 44 | 2893611 | 2893733 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 45 | 28121 | 28243 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 46 | 2063001 | 2063123 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 47 | 58689 | 58811 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 48 | 4695488 | 4695610 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 49 | 4789279 | 4789389 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 50 | 3633792 | 3633902 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 51 | 5465663 | 5465773 | + | NZ_CP054254.1 | Klebsiella variicola |
| 52 | 32319 | 32429 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 53 | 5176620 | 5176730 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 54 | 1713276 | 1713398 | + | NZ_CP011254.1 | Serratia fonticola |
| 55 | 4628129 | 4628236 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 56 | 27915 | 28037 | - | NZ_LT615367.1 | Dickeya aquatica |
| 57 | 1672022 | 1672138 | - | NZ_CP019706.1 | Pantoea alhagi |
| 58 | 4644320 | 4644442 | + | NZ_CP025799.1 | Dickeya zeae |
| 59 | 4686617 | 4686739 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 60 | 61910 | 62032 | - | NZ_LR134531.1 | Pragia fontium |
| 61 | 44587 | 44709 | - | NZ_LS483470.1 | Leminorella richardii |
| 62 | 36501 | 36623 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 63 | 5191326 | 5191448 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 64 | 4082991 | 4083113 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 65 | 4398694 | 4398816 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 66 | 4171782 | 4171904 | + | NZ_CP014137.1 | Brenneria goodwinii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00476.22 | 0.91 | 59 | 3671.5 | opposite-strand | DNA polymerase family A |
| 2 | PF02739.18 | 0.91 | 59 | 3671.5 | opposite-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 3 | PF01612.22 | 0.91 | 59 | 3671.5 | opposite-strand | 3'-5' exonuclease |
| 4 | PF01367.22 | 0.91 | 59 | 3671.5 | opposite-strand | 5'-3' exonuclease, C-terminal SAM fold |
| 5 | PF01926.25 | 1.0 | 65 | 4505 | opposite-strand | 50S ribosome-binding GTPase |
| 6 | PF02421.20 | 0.98 | 64 | 2722 | same-strand | Ferrous iron transport protein B |
| 7 | PF04220.14 | 0.94 | 61 | 1643.5 | opposite-strand | Der GTPase activator (YihI) |
| 8 | PF04055.23 | 0.98 | 64 | 75 | opposite-strand | Radical SAM superfamily |
| 9 | PF06969.18 | 0.98 | 64 | 75 | opposite-strand | HemN C-terminal domain |
| 10 | PF00158.28 | 1.0 | 65 | 111.5 | same-strand | Sigma-54 interaction domain |
| 11 | PF00072.26 | 1.0 | 65 | 111.5 | same-strand | Response regulator receiver domain |
| 12 | PF14532.8 | 1.0 | 65 | 111.5 | same-strand | Sigma-54 interaction domain |
| 13 | PF02954.21 | 1.0 | 65 | 111.5 | same-strand | Bacterial regulatory protein, Fis family |
| 14 | PF07728.16 | 1.0 | 65 | 111.5 | same-strand | AAA domain (dynein-related subfamily) |
| 15 | PF02518.28 | 1.0 | 65 | 1533.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 16 | PF00512.27 | 1.0 | 65 | 1533.0 | same-strand | His Kinase A (phospho-acceptor) domain |
| 17 | PF00120.26 | 1.0 | 65 | 2787.5 | same-strand | Glutamine synthetase, catalytic domain |
| 18 | PF03951.21 | 1.0 | 65 | 2787.5 | same-strand | Glutamine synthetase, beta-Grasp domain |
| 19 | PF00009.29 | 1.0 | 65 | 4576.5 | opposite-strand | Elongation factor Tu GTP binding domain |
| 20 | PF00679.26 | 1.0 | 65 | 4576.5 | opposite-strand | Elongation factor G C-terminus |
| 21 | PF03144.27 | 1.0 | 65 | 4576.5 | opposite-strand | Elongation factor Tu domain 2 |
++ More..