Result : C1P612

Protein Information

• Protein name: Uncharacterized protein YqcG
• NCBI Accession ID: U00096.3
• Organism: Escherichia coli (strain K12)
• Left: 2905557
• Right: 2905697
• Strand: +
• Nucleotide Sequence: ATGTCAGAAGAAAATAAAGAAAATGGATTTAATCATGTCAAAACATTCACCAAAATTATATTTATTTTTTCTGTATTAGTTTTTAATGATAACGAATATAAAATTACCGATGCCGCCGTCAATTTATTTATCCAGATTTAA
• Sequence: MSEENKENGFNHVKTFTKIIFIFSVLVFNDNEYKITDAAVNLFIQI
• Source of smORF: Swiss-Prot
• Pubmed ID: 9278503 16738553 19121005
• Functional Category: Others
• Uniprot ID: C1P612
• ORF Length (Amino Acid): 46

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2905557	2905697	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	2864441	2864581	+	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02913.21	1.0	2	3802.5	opposite-strand	FAD linked oxidases, C-terminal domain
2	PF13394.8	1.0	2	139.0	opposite-strand	4Fe-4S single cluster domain
3	PF00113.24	1.0	2	1314.5	opposite-strand	Enolase, C-terminal TIM barrel domain
4	PF03952.18	1.0	2	1314.5	opposite-strand	Enolase, N-terminal domain
5	PF06418.16	1.0	2	2700.5	opposite-strand	CTP synthase N-terminus
6	PF00117.30	1.0	2	2700.5	opposite-strand	Glutamine amidotransferase class-I
7	PF03819.19	1.0	2	4565.5	opposite-strand	MazG nucleotide pyrophosphohydrolase domain