Result : A1SV86
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein RnfH |
| NCBI Accession ID | CP000510.1 |
| Organism | Psychromonas ingrahamii (strain 37) |
| Left | 1959488 |
| Right | 1959778 |
| Strand | + |
| Nucleotide Sequence | ATGAATGAGTTGATTGAAATTGAAGTTGTTTATGGACGGCCTGATAAACAAGTTTTACTGTCGTTATCTGTGCCAGTCGGTAGCACGCTGGAAGACTGTATTAAGTTATCCGGGATAACCACTCATTTTCCAGAAATTATACCCAGTGAAGCCATGGTTGGTATTTTCAGCCGAGCAGACAAATTATCCAGCATTGTTAAAGCGGGGGATCGTATCGAGATTTATCGTCCGCTAACAGCAGATCCTAAAGAGATGCGCAAATTACGCGCCGCTAAAATGAGTAAAAAATAG |
| Sequence | MNELIEIEVVYGRPDKQVLLSLSVPVGSTLEDCIKLSGITTHFPEIIPSEAMVGIFSRADKLSSIVKAGDRIEIYRPLTADPKEMRKLRAAKMSKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID | |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | A1SV86 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 75
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1959488 | 1959778 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 2 | 700333 | 700623 | + | NZ_LR699114.1 | Aquicella lusitana |
| 3 | 2283983 | 2284267 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 4 | 2575970 | 2576239 | - | NZ_LS483470.1 | Leminorella richardii |
| 5 | 849104 | 849361 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 6 | 5013906 | 5014211 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 7 | 2021554 | 2021787 | - | NZ_CP025120.1 | Kangiella profundi |
| 8 | 2271488 | 2271751 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 9 | 1042730 | 1043038 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 10 | 319352 | 319654 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 11 | 3951627 | 3951917 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 12 | 761740 | 762009 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 13 | 2863128 | 2863391 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 14 | 2728181 | 2728444 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 15 | 702666 | 702935 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 16 | 1183617 | 1183886 | - | NZ_CP061280.1 | Mannheimia bovis |
| 17 | 5771631 | 5771933 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 18 | 4898251 | 4898553 | - | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 19 | 3184064 | 3184339 | - | NZ_CP015581.1 | Tatumella citrea |
| 20 | 897578 | 897868 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 21 | 5540722 | 5540976 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 22 | 3811406 | 3811660 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 23 | 626437 | 626745 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 24 | 909664 | 909966 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 25 | 2179559 | 2179792 | - | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 26 | 1303954 | 1304223 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 27 | 4963849 | 4964106 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 28 | 1269758 | 1270000 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 29 | 488561 | 488887 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 30 | 1140094 | 1140336 | - | NZ_CP046531.1 | Mannheimia ovis |
| 31 | 1284401 | 1284661 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 32 | 768184 | 768498 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 33 | 1107302 | 1107574 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 34 | 702295 | 702603 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 35 | 2339557 | 2339790 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 36 | 77645 | 77902 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 37 | 1794193 | 1794435 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 38 | 1842160 | 1842441 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 39 | 2240926 | 2241183 | + | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 40 | 1081620 | 1081856 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 41 | 5892579 | 5892833 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 42 | 738725 | 738982 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 43 | 1574585 | 1574878 | + | NZ_CP048796.1 | Providencia vermicola |
| 44 | 3037606 | 3037839 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 45 | 2016833 | 2017108 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 46 | 463819 | 464094 | + | NZ_CP035688.1 | Vibrio metoecus |
| 47 | 765522 | 765797 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 48 | 2636829 | 2637089 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 49 | 3804992 | 3805225 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 50 | 2299469 | 2299714 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 51 | 2507711 | 2507989 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 52 | 1254152 | 1254385 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 53 | 1164674 | 1164940 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 54 | 947511 | 947744 | + | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 55 | 2722194 | 2722475 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 56 | 3500668 | 3500913 | - | NZ_CP029736.1 | Providencia rettgeri |
| 57 | 3168192 | 3168485 | - | NZ_CP011797.1 | Reinekea forsetii |
| 58 | 1450797 | 1451030 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 59 | 918758 | 919012 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 60 | 345724 | 346017 | - | NZ_CP026364.1 | Proteus hauseri |
| 61 | 2482152 | 2482394 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 62 | 2806318 | 2806581 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 63 | 905905 | 906168 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 64 | 1086425 | 1086691 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 65 | 1576949 | 1577248 | + | NZ_CP028926.1 | Pasteurella multocida |
| 66 | 2923133 | 2923387 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 67 | 920686 | 920988 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 68 | 5246620 | 5246880 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 69 | 1098359 | 1098607 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 70 | 1183576 | 1183833 | - | NZ_CP037953.1 | Permianibacter aggregans |
| 71 | 1194703 | 1194972 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 72 | 2909162 | 2909428 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 73 | 4272742 | 4272990 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 74 | 5197167 | 5197469 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 75 | 3224436 | 3224738 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699114.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01668.20 | 0.81 | 61 | 643 | opposite-strand | SmpB protein |
| 2 | PF03364.22 | 0.95 | 71 | 33 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 3 | PF10604.11 | 0.93 | 70 | 32.5 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 4 | PF04355.15 | 0.73 | 55 | 64 | opposite-strand | SmpA / OmlA family |
| 5 | PF02463.21 | 0.68 | 51 | 992 | opposite-strand | RecF/RecN/SMC N terminal domain |
++ More..