Result : C1P601
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative lipoprotein RzoQ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1639080 |
| Right | 1639334 |
| Strand | - |
| Nucleotide Sequence | ATGCGCAACAGAAATCTGCTGAAATTTCTGCCAGGGCTGCTTATCTGTCTGATAGTGTTAACCAGTTGCGTGCCGAAGCAAAAAAATATGCCATACGCCTTGACGCAGCGAAGCATACCGCAGATCTTGCCGCTGCCGTCAGAGGCAAAACAACCAAAACCGCCGAAGGAATGCTCACCAACATGCTCGGAGATATTGCAGCAGAAGCTCAGCTTTATGCTGAAATTGCTGACGAACGCTACATCGCAGGAGTGA |
| Sequence | MRNRNLLKFLPGLLICLIVLTSCVPKQKNMPYALTQRSIPQILPLPSEAKQPKPPKECSPTCSEILQQKLSFMLKLLTNATSQE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C1P601 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1639080 | 1639334 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3996034 | 3996288 | + | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07166.13 | 1.0 | 2 | 1655.5 | opposite-strand | Protein of unknown function (DUF1398) |
| 2 | PF08178.13 | 1.0 | 2 | 1299.5 | same-strand | GnsA/GnsB toxin of bacterial toxin-antitoxin system |
| 3 | PF00313.24 | 1.0 | 2 | 413 | same-strand | 'Cold-shock' DNA-binding domain |
| 4 | PF10721.11 | 1.0 | 2 | -254.0 | same-strand | Protein of unknown function (DUF2514) |
| 5 | PF00959.21 | 1.0 | 2 | 190.0 | same-strand | Phage lysozyme |
| 6 | PF07041.13 | 1.0 | 2 | 882.5 | same-strand | Protein of unknown function (DUF1327) |
| 7 | PF04971.14 | 1.0 | 2 | 1318.5 | same-strand | Bacteriophage P21 holin S |
| 8 | PF16080.7 | 1.0 | 2 | 1318.5 | same-strand | Bacteriophage holin family HP1 |
++ More..