Result : C1P5Z8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YkgR |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 313141 |
| Right | 313242 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAGAATAAAGTACAGCAAATCAGTCATAAACTGATTAATATCGTTGTTTTTGTCGCAATTGTAGAATACGCCTATTTATTTCTCCATTTCTATTAA |
| Sequence | MKENKVQQISHKLINIVVFVAIVEYAYLFLHFY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 19121005 19734316 21778229 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C1P5Z8 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 313141 | 313242 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1735937 | 1736038 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 944170 | 944271 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 2725884 | 2725985 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00444.20 | 0.75 | 3 | 724 | same-strand | Ribosomal protein L36 |
| 2 | PF01197.20 | 0.75 | 3 | 461 | same-strand | Ribosomal protein L31 |
++ More..