Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized membrane protein YkgR |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 313141 |
Right | 313242 |
Strand | - |
Nucleotide Sequence | ATGAAAGAGAATAAAGTACAGCAAATCAGTCATAAACTGATTAATATCGTTGTTTTTGTCGCAATTGTAGAATACGCCTATTTATTTCTCCATTTCTATTAA |
Sequence | MKENKVQQISHKLINIVVFVAIVEYAYLFLHFY |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9278503 16738553 19121005 19734316 21778229 |
Domain | |
Functional Category | Others |
Uniprot ID | C1P5Z8 |
ORF Length (Amino Acid) | 33 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 313141 | 313242 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1735937 | 1736038 | + | NZ_CP057657.1 | Escherichia fergusonii |
3 | 944170 | 944271 | - | NZ_LR134340.1 | Escherichia marmotae |
4 | 2725884 | 2725985 | + | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00444.20 | 0.75 | 3 | 724 | same-strand | Ribosomal protein L36 |
2 | PF01197.20 | 0.75 | 3 | 461 | same-strand | Ribosomal protein L31 |