Protein Information |
Information Type | Description |
---|---|
Protein name | Putative inhibitor of glucose uptake transporter SgrT |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 77388 |
Right | 77519 |
Strand | + |
Nucleotide Sequence | ATGCGTCAGTTTTATCAGCACTATTTTACCGCGACAGCGAAGTTGTGCTGGTTGCGTTGGTTAAGCGTCCCACAACGATTAACCATGCTTGAAGGACTGATGCAGTGGGATGACCGCAATTCTGAAAGTTGA |
Sequence | MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES |
Source of smORF | Swiss-Prot |
Function | Acts to promote recovery from glucose-phosphate stress due to intracellular accumulation of glucose-6-phosphate caused by disruption of glycolytic flux or in the presence of (toxic) non-metabolizable glucose phosphate analogs. It may do so by inhibiting the transporter activity for glucose uptake (PtsG) as cells that overexpress this protein do not seem to import glucose although they have nearly wild-type levels of PtsG. {ECO:0000269|Pubmed:18042713}. |
Pubmed ID | 9278503 16738553 18042713 19121005 |
Domain | |
Functional Category | Others |
Uniprot ID | C1P5Z7 |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 77388 | 77519 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 75230 | 75361 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 3515349 | 3515480 | - | NZ_CP061527.1 | Shigella dysenteriae |
4 | 79935 | 80066 | + | NZ_AP014857.1 | Escherichia albertii |
5 | 3625222 | 3625347 | + | NZ_CP057657.1 | Escherichia fergusonii |
6 | 4822832 | 4822954 | - | NZ_CP045205.1 | Citrobacter telavivensis |
7 | 2302319 | 2302441 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
8 | 92972 | 93094 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
9 | 2601462 | 2601584 | - | NZ_CP038469.1 | Citrobacter tructae |
10 | 3077072 | 3077194 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
11 | 1536585 | 1536713 | - | NZ_CP044098.1 | Citrobacter portucalensis |
12 | 3271786 | 3271938 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
13 | 3519899 | 3520027 | + | NZ_CP033744.1 | Citrobacter freundii |
14 | 717091 | 717243 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
15 | 128599 | 128721 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
16 | 720559 | 720711 | + | NC_015968.1 | Enterobacter soli |
17 | 2798813 | 2798965 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
18 | 762373 | 762525 | + | NZ_CP009756.1 | Enterobacter cloacae |
19 | 1791161 | 1791313 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
20 | 741346 | 741498 | + | NZ_AP022508.1 | Enterobacter bugandensis |
21 | 2713660 | 2713782 | + | NZ_CP053416.1 | Salmonella bongori |
22 | 740337 | 740489 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
23 | 3874379 | 3874516 | - | NZ_CP045845.1 | Kluyvera intermedia |
24 | 4517834 | 4517986 | - | NZ_CP014007.2 | Kosakonia oryzae |
25 | 570101 | 570253 | + | NZ_CP015113.1 | Kosakonia radicincitans |
26 | 3881286 | 3881438 | + | NZ_CP017279.1 | Enterobacter ludwigii |
27 | 4162742 | 4162894 | + | NZ_CP023529.1 | Lelliottia amnigena |
28 | 867184 | 867336 | + | NZ_CP043318.1 | Enterobacter chengduensis |
29 | 795129 | 795284 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
30 | 2302925 | 2303077 | - | NZ_CP045300.1 | Kosakonia arachidis |
31 | 2286772 | 2286924 | - | NZ_CP016337.1 | Kosakonia sacchari |
32 | 786882 | 787034 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
33 | 732221 | 732367 | + | NZ_AP023184.1 | Buttiauxella agrestis |
34 | 3860469 | 3860624 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
35 | 4051006 | 4051158 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
36 | 3782877 | 3783029 | - | NZ_CP011602.1 | Phytobacter ursingii |
37 | 5057081 | 5057233 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
38 | 5121668 | 5121805 | - | NZ_CP060111.1 | Klebsiella michiganensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09335.13 | 0.97 | 37 | 5211 | same-strand | SNARE associated Golgi protein |
2 | PF00005.29 | 0.97 | 37 | 4466 | opposite-strand | ABC transporter |
3 | PF00528.24 | 0.97 | 37 | 2872 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
4 | PF13343.8 | 1.0 | 38 | 1913.5 | opposite-strand | Bacterial extracellular solute-binding protein |
5 | PF01547.27 | 1.0 | 38 | 1913.5 | opposite-strand | Bacterial extracellular solute-binding protein |
6 | PF12793.9 | 1.0 | 38 | 89.0 | opposite-strand | Sugar transport-related sRNA regulator N-term |
7 | PF07690.18 | 0.92 | 35 | 122 | same-strand | Major Facilitator Superfamily |
8 | PF00694.21 | 0.84 | 32 | 1390.0 | opposite-strand | Aconitase C-terminal domain |
9 | PF00330.22 | 0.79 | 30 | 2005.5 | opposite-strand | Aconitase family (aconitate hydratase) |
10 | PF00180.22 | 0.76 | 29 | 3405 | opposite-strand | Isocitrate/isopropylmalate dehydrogenase |
11 | PF13191.8 | 0.61 | 23 | 4466 | opposite-strand | AAA ATPase domain |