Result : A1STV3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP000510.1 |
| Organism | Psychromonas ingrahamii (strain 37) |
| Left | 1350712 |
| Right | 1350978 |
| Strand | + |
| Nucleotide Sequence | GTGGGATTGTTAGGATATTTCAGAAGTGATATACCAAAAAAAAGCAGTGCAAAATTAGCGAAAGATCGTTTGCAAATTATCGTTGCGCACGAGCATTCAAATGCAGTGTGCCCGGCATATTTACCTGAAATGCAAAATGAAATTATTGAGGTGATTCGAAAATTTATGAAGATATCAAATGATGATGTTAAATGTGAATTTTCAGATAATGCCGAAGATGACATGTCTGTATTAGAAGTGAATATCACCTTACCTAAAAACAGATAA |
| Sequence | MGLLGYFRSDIPKKSSAKLAKDRLQIIVAHEHSNAVCPAYLPEMQNEIIEVIRKFMKISNDDVKCEFSDNAEDDMSVLEVNITLPKNR |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | A1STV3 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1350712 | 1350978 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 2 | 982614 | 982877 | - | NZ_CP013188.1 | Pseudoalteromonas phenolica |
| 3 | 394442 | 394705 | + | NZ_CP072426.1 | Pseudoalteromonas viridis |
| 4 | 192822 | 193085 | - | NZ_CP032091.1 | Pseudoalteromonas donghaensis |
| 5 | 571583 | 571849 | - | NC_007482.1 | Pseudoalteromonas translucida |
| 6 | 614880 | 615146 | - | NZ_CP011037.1 | Pseudoalteromonas nigrifaciens |
| 7 | 302146 | 302409 | - | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 8 | 718100 | 718363 | - | NZ_CP011026.1 | Pseudoalteromonas arctica A 37-1-2 |
| 9 | 714221 | 714484 | - | NZ_CP011029.1 | Pseudoalteromonas espejiana DSM 9414 |
| 10 | 69295 | 69558 | + | NZ_CP027524.1 | Pseudoalteromonas carrageenovora |
| 11 | 572335 | 572598 | - | NZ_CP033066.1 | Pseudoalteromonas agarivorans |
| 12 | 659827 | 660090 | - | NZ_CP011031.1 | Pseudoalteromonas issachenkonii |
| 13 | 660107 | 660370 | - | NZ_CP011042.1 | Pseudoalteromonas tetraodonis |
| 14 | 2359143 | 2359400 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 15 | 2281758 | 2282015 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 16 | 583554 | 583820 | - | NZ_CP072135.1 | Pseudoalteromonas xiamenensis |
| 17 | 764458 | 764721 | - | NZ_CP031962.1 | Pseudoalteromonas tunicata |
| 18 | 1891817 | 1892083 | - | NC_007954.1 | Shewanella denitrificans OS217 |
| 19 | 1969792 | 1970049 | + | NZ_CP061081.1 | Marinomonas arctica |
| 20 | 1948601 | 1948861 | - | NZ_CP041036.1 | Shewanella polaris |
| 21 | 3031097 | 3031357 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 22 | 2043323 | 2043583 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 23 | 2244181 | 2244438 | - | NZ_CP054301.1 | Marinomonas primoryensis |
| 24 | 715954 | 716220 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 25 | 2831039 | 2831299 | + | NC_014012.1 | Shewanella violacea DSS12 |
| 26 | 4451261 | 4451521 | - | NZ_CP036200.1 | Shewanella maritima |
| 27 | 1864423 | 1864680 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 28 | 2286503 | 2286763 | - | NZ_CP046378.1 | Shewanella algae |
| 29 | 1762547 | 1762801 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 30 | 1455812 | 1456075 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 31 | 1766006 | 1766254 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 32 | 854337 | 854597 | + | NZ_LS483250.1 | Moritella yayanosii |
| 33 | 1960484 | 1960747 | - | NZ_CP037951.1 | Parashewanella tropica |
| 34 | 3403842 | 3404096 | + | NZ_CP009365.1 | Pseudomonas soli |
| 35 | 2550074 | 2550328 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 36 | 2068595 | 2068852 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 37 | 3586930 | 3587184 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 38 | 2716139 | 2716399 | + | NZ_CP020472.1 | Shewanella japonica |
| 39 | 2727188 | 2727451 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 40 | 2020668 | 2020961 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 41 | 1150908 | 1151162 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 42 | 1233305 | 1233559 | + | NZ_CP036536.1 | Salinimonas lutimaris |
| 43 | 782505 | 782762 | - | NZ_CP011040.1 | Pseudoalteromonas spongiae UST010723-006 |
| 44 | 2281291 | 2281560 | - | NZ_AP022188.1 | Aeromonas media |
| 45 | 2270190 | 2270447 | - | NC_016901.1 | Shewanella baltica OS678 |
| 46 | 50754 | 51041 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 47 | 3185230 | 3185481 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 48 | 882537 | 882794 | + | NZ_CP009889.1 | Pseudoalteromonas piratica |
| 49 | 714107 | 714391 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 50 | 2119629 | 2119883 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 51 | 1457302 | 1457556 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 52 | 4603933 | 4604187 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 53 | 742709 | 742960 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
| 54 | 982815 | 983069 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 55 | 2549159 | 2549413 | - | NZ_CP061941.1 | Marinomonas algicola |
| 56 | 3397018 | 3397272 | + | NZ_CP020931.1 | Marinobacter salarius |
| 57 | 3386104 | 3386358 | - | NZ_CP008849.1 | Alteromonas australica |
| 58 | 2265606 | 2265890 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 59 | 1052161 | 1052436 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 60 | 1051118 | 1051369 | - | NZ_CP011494.1 | Marinobacter psychrophilus |
| 61 | 3367260 | 3367511 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 62 | 249110 | 249367 | - | NZ_CP070273.1 | Marinomonas foliarum |
| 63 | 2290334 | 2290588 | + | NZ_CP013480.3 | Pandoraea norimbergensis |
| 64 | 88235 | 88501 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 65 | 356698 | 356913 | + | NZ_CP045074.1 | Paracoccus kondratievae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008709.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03775.18 | 1.0 | 65 | 840 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 2 | PF05209.15 | 0.94 | 61 | 840 | same-strand | Septum formation inhibitor MinC, N-terminal domain |
| 3 | PF13614.8 | 1.0 | 65 | 3 | same-strand | AAA domain |
| 4 | PF01656.25 | 1.0 | 65 | 3 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF10609.11 | 0.94 | 61 | 2 | same-strand | NUBPL iron-transfer P-loop NTPase |
++ More..