Protein Information |
Information Type | Description |
---|---|
Protein name | N(2)-fixation sustaining protein CowN (CO weal-nitrogenase) |
NCBI Accession ID | CP001157.1 |
Organism | Azotobacter vinelandii (strain DJ / ATCC BAA-1303) |
Left | 4773626 |
Right | 4773919 |
Strand | + |
Nucleotide Sequence | ATGTCCACGACCACCTATCGCAGCATCTGCGGCGAAGAATCTCTGCCCTACATCGACTGCGACCGCTGCATCCGCGCCCTCTACGCGCGGCTCCAGCACTACGTGCAGCAGGACCGGGGCGATTGTCCGATCTGCGCCTATTTCCGCGAAAAGATCGGCTCGCGCGACGGCAGCGAAAGCGATGCCCGCCTGCTGCTGCACGCCCAGGTGAACGTCGTCTACGAACTCTTCGCCCGCCACGCCGACCAGGAGGCCCTGGCCCTGCTGGAGCGGATCGAAGACGACTGCTGCTGA |
Sequence | MSTTTYRSICGEESLPYIDCDRCIRALYARLQHYVQQDRGDCPICAYFREKIGSRDGSESDARLLLHAQVNVVYELFARHADQEALALLERIEDDCC |
Source of smORF | Swiss-Prot |
Function | Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. {ECO:0000255|HAMAP-Rule:MF_02117}. |
Pubmed ID | 19429624 |
Domain | CDD:411285 |
Functional Category | Others |
Uniprot ID | C1DIY8 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4773626 | 4773919 | + | NC_012560.1 | Azotobacter vinelandii DJ |
2 | 3292728 | 3293021 | - | NZ_CP045302.1 | Azotobacter salinestris |
3 | 521723 | 522016 | - | NZ_CP011835.1 | Azotobacter chroococcum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00814.27 | 1.0 | 3 | 5208 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
2 | PF01165.22 | 1.0 | 3 | 4791 | same-strand | Ribosomal protein S21 |
3 | PF08275.13 | 1.0 | 3 | 2772 | same-strand | DNA primase catalytic core, N-terminal domain |
4 | PF01807.22 | 1.0 | 3 | 2772 | same-strand | CHC2 zinc finger |
5 | PF08278.13 | 1.0 | 3 | 2772 | same-strand | DNA primase DnaG DnaB-binding |
6 | PF13662.8 | 1.0 | 3 | 2772 | same-strand | Toprim domain |
7 | PF13155.8 | 1.0 | 3 | 2772 | same-strand | Toprim-like |
8 | PF10410.11 | 1.0 | 3 | 2772 | same-strand | DnaB-helicase binding domain of primase |
9 | PF01751.24 | 1.0 | 3 | 2772 | same-strand | Toprim domain |
10 | PF13362.8 | 1.0 | 3 | 2772 | same-strand | Toprim domain |
11 | PF04546.15 | 1.0 | 3 | 850 | same-strand | Sigma-70, non-essential region |
12 | PF04539.18 | 1.0 | 3 | 850 | same-strand | Sigma-70 region 3 |
13 | PF03979.16 | 1.0 | 3 | 850 | same-strand | Sigma-70 factor, region 1.1 |
14 | PF04542.16 | 1.0 | 3 | 850 | same-strand | Sigma-70 region 2 |
15 | PF04545.18 | 1.0 | 3 | 850 | same-strand | Sigma-70, region 4 |
16 | PF00140.22 | 1.0 | 3 | 850 | same-strand | Sigma-70 factor, region 1.2 |
17 | PF13545.8 | 1.0 | 3 | 77 | same-strand | Crp-like helix-turn-helix domain |
18 | PF00027.31 | 1.0 | 3 | 77 | same-strand | Cyclic nucleotide-binding domain |
19 | PF00325.22 | 0.67 | 2 | 75.0 | same-strand | Bacterial regulatory proteins, crp family |
20 | PF04011.14 | 0.67 | 2 | 386.0 | same-strand | LemA family |
21 | PF04536.16 | 0.67 | 2 | 997.0 | same-strand | TPM domain |
22 | PF02464.19 | 0.67 | 2 | 3818.0 | opposite-strand | Competence-damaged protein |