Result : C1D186
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP001114.1 |
| Organism | Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) |
| Left | 919204 |
| Right | 919452 |
| Strand | - |
| Nucleotide Sequence | ATGTTGGGATTTGGACCTTTTGAACTGATTCTGATCGTGGTGATCATCGCGCTGCTGTTCGGCGCACGCAAACTGCCGGAGCTCGGCAAGGGCATGGGACGCGGCATCAAGGAATTCAAGCAGGAAATGCACGAACCCTCTCCCCCTCGGCCACAGGTGACGGATATTCCTTCCCAGCGCCTGGACCCGGTGACAGGTGCGCCAGTCAGTACCGAAAGCACAGTCCCGGCCAGCGACCGCCGTTCCTGA |
| Sequence | MLGFGPFELILIVVIIALLFGARKLPELGKGMGRGIKEFKQEMHEPSPPRPQVTDIPSQRLDPVTGAPVSTESTVPASDRRS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 19370165 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | C1D186 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 919204 | 919452 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 2 | 2746078 | 2746317 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 3 | 754852 | 755082 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
| 4 | 2487687 | 2487914 | + | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 5 | 2500075 | 2500329 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 6 | 1253487 | 1253735 | - | NZ_CP021081.1 | Deinococcus ficus |
| 7 | 2619362 | 2619610 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012526.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00132.26 | 0.71 | 5 | 2000 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 2 | PF00483.25 | 0.71 | 5 | 1939 | same-strand | Nucleotidyl transferase |
| 3 | PF01790.20 | 1.0 | 7 | 921 | same-strand | Prolipoprotein diacylglyceryl transferase |
| 4 | PF00902.20 | 1.0 | 7 | 20 | same-strand | Sec-independent protein translocase protein (TatC) |
| 5 | PF13561.8 | 1.0 | 7 | 415 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 6 | PF00106.27 | 1.0 | 7 | 1805.0 | same-strand | short chain dehydrogenase |
| 7 | PF13460.8 | 1.0 | 7 | 415 | same-strand | NAD(P)H-binding |
++ More..